KEGG   Vibrio anguillarum 775: VAA_02633Help
Entry
VAA_02633         CDS       T01536                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
van  Vibrio anguillarum 775
Pathway
van00400  Phenylalanine, tyrosine and tryptophan biosynthesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01130  Biosynthesis of antibiotics
van01230  Biosynthesis of amino acids
Module
van_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAA_02633
Enzymes [BR:van01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VAA_02633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin Cytidylate_kin2 APS_kinase dNK AAA_17 AAA_16 ABC_tran TsaE AAA_22 AAA AAA_25 Ploopntkinase3 ATPase_2 AAA_5 RNA_helicase AAA_7 AAA_PrkA AAA_24 CoaE AAA_28 His_biosynth AAA_29 RsgA_GTPase IstB_IS21 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AEH32143
UniProt: F7YK65
LinkDB All DBs
Position
I:591730..592251
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFLDSDTVIEERTGADIAWVFDVEGEEGFR
KREEAVINDLTEKQGIVLATGGGSVKSKENRNRLSARGIVVYLETTIEKQLARTNRDKKR
PLLQTDNPREVLECLADERNDLYAEIADFTVRTDDQGAKVVANEIVKMLEEHS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatattttccttgttggcccaatgggcgccggcaaaagtacaatt
ggtagacatcttgctcaacaactgcatatggagtttttagactcagatacagtcattgaa
gagcgtacaggcgcagatatcgcatgggtatttgacgtcgaaggtgaagagggcttccgt
aaacgtgaggaagctgtaattaatgacctaaccgagaaacaaggtattgtactcgcaaca
ggcggtggttctgttaagagtaaagaaaaccgtaatcgtttatctgctcgtggtattgtg
gtctaccttgaaacgacgattgaaaaacaacttgcacgcacgaaccgtgacaaaaaacgg
ccattgcttcaaacagacaatccacgtgaagtcttagaatgcttggctgatgaacgtaac
gatctttacgctgagatcgctgattttacggttcgtactgacgatcaaggtgcaaaagtg
gtagccaacgagatcgtaaaaatgctagaagaacattcctaa

DBGET integrated database retrieval system