KEGG   Vibrio anguillarum 775: VAA_03030Help
Entry
VAA_03030         CDS       T01536                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
van  Vibrio anguillarum 775
Pathway
van00473  D-Alanine metabolism
van00550  Peptidoglycan biosynthesis
van01100  Metabolic pathways
van01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAA_03030
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_03030
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VAA_03030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_03030
Enzymes [BR:van01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VAA_03030
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Precursor biosynthesis
  Amino acid ligase
   VAA_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATPgrasp_ST ATPgrasp_YheCD ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AEH33025
UniProt: F7YHZ2
LinkDB All DBs
Position
I:1539473..1540627
Genome map
AA seq 384 aa AA seqDB search
MTHSVFSTQQLEWIRKNLKIAVIHGGDKEQEGSFIFENLSPRSTKTYAPVAHDIANALRE
SNFQFVEVLAEDINLAQCLKDKGIDLVITNSGGLQGFDSMCHLPSTLEMLGVPYVGHSPM
TAGILDNKHLFKHEIKAAGLPTAPFITIGIDEHFEDVAKQDAIDQIEAQFKDGFIVKPVS
GRASIHVYPVFKRNDLAGVVEHVRQATGNTVMIEPFLGGREFVVAVAGEYVFKEGKLTQS
EMPMAFSITERVLDADEPIFTSMDVKPITQDRLVAVNEEGLRNQLALIGQKIYRLLGLQT
LVRVDLRMDKEGNLYVLETNPKPDLKRPEGEKVSLVCHDLAREGMDYTDLVQSLVFNRLS
FLKQKRPMSVAHCLNEQFDALSVC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgcattcagttttttctacgcaacaattggaatggattcgtaagaacttaaaaatc
gcagtgattcacggtggtgataaagagcaggagggcagttttatctttgaaaacttgagc
cctcgctcaactaaaacgtatgcacctgttgcacacgatattgctaatgcactgcgtgaa
tctaatttccaattcgttgaggtgttagctgaagacattaacttagcgcagtgcctgaaa
gataaaggtattgacttggtgatcacgaacagtggtggtttgcaaggttttgactccatg
tgtcatttgccttctacattggaaatgctgggcgtgccttatgtagggcactcgccaatg
acggcagggatcttggataacaagcacctgtttaagcatgaaattaaagccgctggactg
ccgactgcgccatttatcaccattggtattgatgagcattttgaagatgtagcaaagcaa
gatgcgatcgatcaaattgaagcacagttcaaagacggcttcattgttaagccagtgtct
ggccgagcttcaatccatgtttatcctgtttttaagcgtaatgatctcgcgggtgttgta
gagcatgtacgtcaagcgacggggaatacagtaatgattgaacctttccttggtggccga
gagtttgttgttgctgttgcgggagagtatgtctttaaagaaggtaaactgacgcagtct
gaaatgcctatggctttctcaattactgaacgtgtactggatgctgacgagcctattttt
acttccatggatgtaaagccgatcactcaagaccgtttggttgctgttaatgaagagggg
ctacgcaatcagttagcactgatcggtcagaagatttatcgcctgcttggtcttcaaacc
ttagtgagagtggacttacgcatggacaaagaaggcaacctttatgtgctggaaaccaat
ccaaaaccggatctcaaacgtccggagggagagaaggtaagtttggtttgccatgatctg
gctcgtgaaggtatggattacacagacctagttcagtcgttggtgtttaaccgattatct
ttccttaagcaaaaacgcccaatgtcggttgcgcattgcctcaatgagcaattcgacgct
ctaagcgtgtgttag

DBGET integrated database retrieval system