KEGG   Vibrio anguillarum 775: VAA_03319Help
Entry
VAA_03319         CDS       T01536                                 

Definition
(GenBank) Alanine aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
van  Vibrio anguillarum 775
Pathway
van00220  Arginine biosynthesis
van00250  Alanine, aspartate and glutamate metabolism
van00290  Valine, leucine and isoleucine biosynthesis
van01100  Metabolic pathways
van01110  Biosynthesis of secondary metabolites
van01130  Biosynthesis of antibiotics
van01210  2-Oxocarboxylic acid metabolism
van01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VAA_03319
   00290 Valine, leucine and isoleucine biosynthesis
    VAA_03319
   00220 Arginine biosynthesis
    VAA_03319
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:van01007]
    VAA_03319
Enzymes [BR:van01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     VAA_03319
    2.6.1.66  valine---pyruvate transaminase
     VAA_03319
Amino acid related enzymes [BR:van01007]
 Aminotransferase (transaminase)
  Class I
   VAA_03319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP ERCC3_RAD25_C
Motif
Other DBs
NCBI-ProteinID: AEH32749
UniProt: F7YKF0
LinkDB All DBs
Position
I:complement(1223658..1224872)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKKGLRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTASVALSGGTAVHYLCDEEADWYPDLNDINSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIVEIARKHKLIIFADEIYDKILYDGATHTPISTLADDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKHIAKGYVAGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYLFPKIDTKMYSIKDDQKMVLDFLKQEK
VLLVQGTGFNWPKPDHFRIVTLPHIEDLEIAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctatgacattaggggtcct
gtactcaaacatgctaaacgcatggaggaagaggggcataaaatactgaagttaaacatt
ggtaaccccgccccatttggctttgacgccccagatgaaatcctagttgatgtgatccgt
aatctgcctacttcacaaggctattgcgactcaaaggggatctattccgcgcgcaaagcc
gtggtgcaacactaccagaaaaaagggctacgtagcctagatgtagaagatgtttacatc
ggtaatggtgcttcagagcttatcgtgatggcgatgcaagcgctgcttaataatggcgat
gaaatgcttgtccctgctcctgattatccattatggaccgcttcggtcgccctctccggt
ggcactgctgtgcattacttgtgtgatgaagaagccgattggtatcctgatctcaacgac
atcaacagtaaaatcacgcccaaaacacgcggtattgtgttgatcaaccccaataaccca
acaggtgctgtctatagccgtgatttcctgctggaaattgttgagattgcccgcaagcat
aaattgatcattttcgccgacgaaatctacgacaaaatcttatacgatggtgcaacccat
acgcccatttcaacactggctgatgacgttttaatggtcacttttaacggcctgtcaaaa
gcgtaccgtgtgtgcgggttccgtggtggttggatgttccttaccgggccaaaacacatc
gccaaaggttatgtggctggtttggaaatgcttgcctcaatgcgtttgtgtgccaacgtg
cccatgcagcatgcgattcaaaccgcattaggtggctatcaaagtatcaatgagctgatt
ttacccggcggccgactgctcgaacagcgcgatcgcgcgtgggaattgatcaaccagatc
cccggcgtctcatgtgtcaaacctaaaggagccatgtacctgttcccgaaaatcgacacg
aaaatgtacagcattaaagatgaccaaaaaatggtgctcgacttcttaaaacaagagaaa
gtgctattggttcaaggaacgggctttaactggccaaaaccggaccacttccgcattgtc
accttaccgcatattgaagatttggaaattgccattggccgcttcgaacgtttcttatcg
acctacagtcagtag

DBGET integrated database retrieval system