KEGG   Vibrio anguillarum 775: VAA_03368Help
Entry
VAA_03368         CDS       T01536                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
van  Vibrio anguillarum 775
Brite
Enzymes [BR:van01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VAA_03368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEH32701
UniProt: F7YNQ5
LinkDB All DBs
Position
I:complement(1171300..1171884)
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEAFKAKFTDSAINNFG
SSWTWLVKNADGSLEIINTSNAATPLTHEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWAFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattaccagctttgccttacgctaaagacgctctagaaccacacatttca
gccgaaacactagatttccaccacggtaagcaccacaacacttacgttgtgaagcttaac
ggccttatccctggcactgaatttgaaggtaaatctctcgaagagatcatcaaaacttca
actggtggcgtgtttaataacgccgctcaaatttggaaccacaccttctattggcactgc
cttgcaccaaatgcaggtggcgaaccaacaggtgccgttgcagacgcaatcaacgccgca
tttggttcttttgaagcttttaaagcaaaattcactgactcagcgatcaataactttggt
tcatcttggacttggttggtgaaaaatgcggatggttctttagagatcatcaacacttca
aatgcagccacaccactgactcacgaaggtgtaactccgctactgacggttgatctgtgg
gaacacgcttactacatcgattaccgtaacctacgccctgactacatgaatggtttctgg
gcactggttaactgggcattcgttgcagaaaacctagcaaaataa

DBGET integrated database retrieval system