KEGG   Vibrio anguillarum 775: VAA_03715Help
Entry
VAA_03715         CDS       T01536                                 

Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
van  Vibrio anguillarum 775
Pathway
van00471  D-Glutamine and D-glutamate metabolism
van00550  Peptidoglycan biosynthesis
van01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:van00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VAA_03715
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAA_03715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
    VAA_03715
Enzymes [BR:van01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     VAA_03715
Peptidoglycan biosynthesis and degradation proteins [BR:van01011]
 Precursor biosynthesis
  Amino acid ligase
   VAA_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AEH32379
UniProt: F7YLS5
LinkDB All DBs
Position
I:825010..826470
Genome map
AA seq 486 aa AA seqDB search
MTIKHTQDLAQIRAMVPEMRRVKCIHFVGIGGAGMSGIAEVLLNEGYQITGSDLASNPVT
ERLASKGAIIYIGHQATNIELASVVVVSTAIDELNPELKAARERRIPIVRRAEMLAELMR
FRHGIAVAGTHGKTTTTALVTQIYSEAGLDPTFVNGGLVKSAGTNARLGSSRILIAEADE
SDASFLHLQPMVSIVTNIEADHMDTYGGDFETLKQTFIDFLHNLPFYGQAILCIDDPVVR
EIIPRISRQVITYGFADDADVRIENYHQQGQQGQFTVVRQGRANLDITLNIPGRHNALNA
SAAIAVATEDDISDEAILKAMASTQGTGRRFDHLGEFDTGNGVAMLVDDYGHHPTEVGVT
IKAARSGWQEKRLVMIFQPHRYSRTRDLYDDFANVLEQVDVLIMLDVYAAGEKPIAGADG
RSLCRTIRSRGKIDPIFVPDSTILPSILANVLQDGDLVLTQGAGDIGKVAKHLAGLELNI
SKMQQV
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccattaaacatactcaagatttagctcaaatccgcgccatggtgccagagatgcgc
cgcgtcaagtgtattcactttgtcggtattggtggggcgggaatgagcggaattgcagaa
gtattgctcaatgaaggctaccaaattaccggctctgatctcgcttccaaccctgtgact
gaaagattggcaagtaaaggggctatcatttatatcggtcatcaagccactaatattgaa
ctcgccagtgtggtggtagtctctactgcaatcgatgagctaaatcctgaactgaaagcg
gcgcgtgagcgacgcattcctattgttcgtcgtgcagaaatgttggcggaattaatgcgt
tttcgtcatggcattgcggtggctggtacgcatggtaaaacaacgactacggcattggtt
acgcaaatttattctgaggctggtttagatcctacgtttgttaatggcgggttagtcaaa
agcgctggcaccaatgcgcgtttgggttcaagccggattttgattgctgaagctgacgaa
agtgatgcttcattccttcatcttcagcctatggttagtatcgtgaccaacatcgaagct
gatcacatggatacgtatggcggtgattttgaaacgcttaaacaaaccttcatcgatttc
ttacacaacctgccattttatggtcaggcgatattatgtattgatgatcctgttgtgcgt
gaaatcatcccacgtatcagccgtcaagtgatcacctacggttttgccgatgatgcagat
gtcaggattgagaattaccatcagcaggggcaacaaggccagtttacggtcgtcagacag
ggacgagccaatctggatatcacgcttaatattccaggtcgtcataatgcgcttaatgcc
tccgcggctattgcagtggcaacggaagacgacatcagcgatgaagcgattttaaaagcg
atggctagcacccaaggtacgggacgtcgttttgatcatctgggcgagtttgatacgggc
aatggggttgcgatgctcgttgatgattatggtcatcatccgaccgaggtgggcgtgact
attaaggcggcgcgtagtggttggcaagaaaaacggctagtgatgattttccaacctcat
cgctacagtcgaactcgcgatctgtatgatgattttgccaatgtactggagcaagtcgat
gtgctgatcatgctcgatgtctatgccgcaggagaaaagccgattgcgggagccgatggt
cgatcgttgtgccgaacgatacgcagtcgcggtaaaattgatcctatttttgttcccgac
agcaccatactgccttcgattctggctaatgtattacaagatggtgacctcgtgctgacg
caaggtgctggggatatcggcaaggtagcgaaacatttagcggggctcgaactgaatatc
agtaaaatgcaacaggtttaa

DBGET integrated database retrieval system