KEGG   Vagococcus sp. MN-17: FA707_02125Help
Entry
FA707_02125       CDS       T05965                                 

Definition
(GenBank) aquaporin family protein
  KO
K02440  glycerol uptake facilitator protein
Organism
vao  Vagococcus sp. MN-17
Brite
KEGG Orthology (KO) [BR:vao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vao02000]
    FA707_02125
Transporters [BR:vao02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    FA707_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: QCI85834
UniProt: A0A4D7CSG6
LinkDB All DBs
Position
complement(441418..442131)
Genome map
AA seq 237 aa AA seqDB search
MSADMTQIMGEFIGTAILILLGGGVCAACNLNKSKAQNAGWIVIAFGWAMAVTIAVFISG
FMGPAHLNPAVTIAMAMNGNISWGLVIPFIIAQVLGAIVGAILVWLAYLPHWDETEDQGA
ILGTFATGPAIRNLPANMITEAIGTFVLVLALLAFGNNDLQFGNNVFAVGAVILAVGLSL
GGPTGYAINPARDLGPRIAHAFLPIKNKGDSDWGYALVPIIGPIIGAIIAVLVFKMF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcagatatgacacaaattatgggtgaatttattggaactgcaattttaatttta
ttagggggcggcgtttgtgcggcctgtaatttaaacaaaagtaaagcgcaaaatgccggt
tggatcgtcattgcatttggttgggcaatggccgtaaccatcgcagtctttatttcaggt
ttcatggggcctgctcatttaaatccagcagtgacaatcgccatggcaatgaatggtaat
atttcgtggggattagtgataccatttattattgcgcaagtcttaggggcgattgttggt
gccattttagtttggttagcatatttaccacattgggatgaaacggaagatcaaggcgct
attttaggtacatttgcaactggtcctgctattcgcaatttaccagcgaatatgattacc
gaagcgattggaaccttcgtgttagtattagctttattagcgtttggcaacaacgactta
caatttggtaacaatgtctttgccgttggtgctgttatcttagccgttggtctttcatta
ggaggaccaactggttatgcgattaacccggcccgtgacctaggcccaagaattgctcat
gcatttttaccaatcaaaaacaaaggagactctgactggggctatgctttagttccaatc
attggaccaattatcggcgcaataattgcggtattagtatttaagatgttttaa

DBGET integrated database retrieval system