KEGG   Vagococcus sp. MN-17: FA707_02295Help
Entry
FA707_02295       CDS       T05965                                 

Definition
(GenBank) YhgE/Pip domain-containing protein
  KO
K01421  putative membrane protein
Organism
vao  Vagococcus sp. MN-17
Brite
KEGG Orthology (KO) [BR:vao00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    FA707_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane Baculo_PEP_C MnmE_helical Sec20 Paf1 T3SSipB Mce4_CUP1 APG17 TANGO2 Prominin Not3 Filament NPV_P10 Myosin_tail_1
Motif
Other DBs
NCBI-ProteinID: QCI85867
LinkDB All DBs
Position
478467..481190
Genome map
AA seq 907 aa AA seqDB search
MKRLKKVFELYRLDWHRVYQNKLTLMLIMALMVIPSLYAWFNIAALWDPYSSTGDIKVAI
YSEDKRAEVMDKSVNIGDEMLKNLKENDNFSWQFVKSEAELDKGVKSGKYYAGIVIPSDF
SKNLVSFVNGDIKKPEIDYRVNQKINAIAPKVTEKGASAIQSTIATQFIDTVSKTVFETL
NQAGYKIDEGLPTLNKVTSKILLADEHLDEIDGYTKKITELNDKFPEYKEKLDKANEVVD
YLPKVNEVGDKLVELNKKLPELKKVGELVVTLQGKTDQIKEAGKQIKTIDEEFDKIVETL
NKAVDTSKKGLKIIGEAQEMLPDVQRFVDQANGTLPTVIDEVGKIQTALPQIGDGLTSGL
NVVVLVAQNVMTTTDNLNAFLDKTELDDETRAAIKQVLVVLQTQSAKLDQMITNVINTLN
KLMALAGDNSLQPVVDRLKNIQTAGQGLNQFVTSVVNGFDSMNTEEIKDSISKINQIAGE
IGSHATNLEGELPSIQTTITGILTNVSAMLDTANNLTHKVDEQNMLAQLDDVMSNTTETI
NTALKFFDEYQSELPKIKEEIHTANVLLNDNMTTVIDGIDKAASFYQNDLPKLEEKMNQG
VAFYQKEWPAIEEELTKTLGTVNEKMPDIEKALTLSTGFINDEWPEVRNGIQKAADLVRK
GQNNVDLGSLISLLKKDANDESDFLSNPVKINEQDIYPVPNYGSASAPFYTALCLWVGSV
LFSSIATTVVHLDGKQKKRYSMRQQYVSRYMTFITVGLAQAAIVALGNRFLLNAYMVNPG
WNFLFTLLISLVFMSMVYALVHLFGNLGKGMAVIILVLSISAGGGNFPIQMSGKFFNMIH
PFLPFTYAVNLLRETTGGIYWPNAIKNIIVLAAVGATFAIIGYILAPKVTTIFRKLNAKL
KEGHLLH
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgaaaaaagtatttgaattgtatcgcctagattggcatcgtgtttatcaa
aataaattaacgttaatgttgatcatggctttaatggttattccttcattatatgcatgg
tttaatattgcagctttatgggatccgtattcaagtacgggagatattaaagtagcgatt
tactcagaagataaacgtgcagaggtaatggacaaatcggtcaatattggcgatgaaatg
ctgaaaaatttgaaagaaaatgataatttttcctggcaatttgttaaatcagaagctgag
ttagataagggtgttaaaagtggaaaatattatgcaggaattgtcattcctagcgacttt
tccaaaaacttggttagttttgtcaatggtgacattaaaaaacctgaaattgattatcgt
gtgaatcaaaaaattaatgcgattgcgccaaaagtaacagaaaaaggagcgagtgctatt
cagtcaacgattgccactcagttcattgatacagttagcaaaaccgtttttgagaccttg
aatcaagcaggttacaaaatcgatgaaggactgcctaccttaaataaggtgacaagtaaa
atattattggcagatgagcatttagatgaaattgatggctacactaaaaaaattacggaa
ctaaatgataagtttccagaatataaagaaaaactagataaagccaatgaagtggtggat
tatttaccaaaagtaaatgaagtaggcgataagttagtcgaattaaataaaaaattgcca
gaactaaaaaaagttggagaattagttgtcacccttcaaggcaaaactgaccaaataaaa
gaggctggtaagcaaattaaaacgattgacgaagagtttgacaagatcgtcgaaacgtta
aataaagcagttgatacatctaaaaaaggcttaaagattattggagaagcgcaagaaatg
ttgcctgatgttcaaagatttgttgatcaagcgaatggtacgttaccgacagttattgat
gaagtaggaaaaattcaaaccgccttaccacaaattggtgacggcttgacgtctggttta
aacgtggttgtgttagtcgctcaaaatgttatgacaacaaccgataatttgaatgcattt
ctagataaaactgagttagacgatgaaacaagagctgcaattaaacaagtattagtcgtt
cttcaaacacaatcggccaaattagatcaaatgattacaaatgtgattaatactctaaat
aaattaatggcgttagctggtgataatagtttacaaccggttgtcgatcgtttgaaaaat
atccaaacagctggacaaggcttgaatcaatttgtgacaagtgtcgtgaatggtttcgat
tcaatgaatactgaagagattaaagatagtatctctaaaattaatcaaatagctggagaa
attggttctcatgcaacgaacctagaaggtgaattaccttcaattcagacaactattacg
ggaattttgaccaatgtttcagcgatgcttgatacagcgaataacctgacacataaagtc
gatgaacaaaatatgttagcacaactagatgatgtgatgtcaaatacgaccgagaccatc
aatacggcacttaaattctttgacgagtatcaaagtgaattgccaaaaattaaagaagaa
attcatactgccaatgttttattgaatgacaatatgacgacagtgatagatggtatcgat
aaagcggctagtttttatcaaaatgacctacctaagttagaagaaaagatgaatcaaggc
gtggcgttttatcaaaaagaatggccagcaattgaagaagagttgaccaaaacgttagga
acagttaatgagaaaatgcctgatattgagaaagctttaacgctatcaacaggctttatt
aacgacgaatggccagaagtgcgtaatggtattcaaaaagcggctgatttagttcgaaaa
ggtcaaaataatgttgatttaggttctttgattagtttgcttaaaaaagatgctaatgat
gagagtgacttcttgtcaaatccagttaaaattaatgagcaagatatctatccagttcct
aactatggatcagcaagtgccccattctatacagcgttgtgtctgtgggttggatcggtc
ttgttctcaagtattgcgacaacagtggtgcacttagatggtaaacagaagaagcgttac
agcatgcgtcaacaatatgtttctcgctacatgacctttataacagtaggattggcccaa
gcagctatcgtagcattaggtaatcgtttcttattgaatgcctatatggttaatccagga
tggaacttcttatttactttgttgattagtttagtcttcatgtcaatggtttatgcctta
gtccatttatttggtaatttaggtaaaggaatggcggttataatattagtgttgtctatt
tcagcagggggtgggaacttcccaattcaaatgtccggtaagttctttaatatgattcat
ccattcttaccatttacttatgcggttaatttgttaagagaaacaacaggtggtatttac
tggccaaatgcgataaaaaatattatcgtattagccgcagttggggcaacatttgctata
ataggttatatcctagcaccaaaagtaaccacaatctttagaaaattaaatgctaaatta
aaagaaggacatttattgcattag

DBGET integrated database retrieval system