KEGG   Vagococcus sp. MN-17: FA707_06780Help
Entry
FA707_06780       CDS       T05965                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vao  Vagococcus sp. MN-17
Brite
KEGG Orthology (KO) [BR:vao00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vao01001]
    FA707_06780 (pknB)
Enzymes [BR:vao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     FA707_06780 (pknB)
Protein kinases [BR:vao01001]
 Serine/threonine kinases: Other
  Bacterial family
   FA707_06780 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kdo APH Haspin_kinase RIO1 Seadorna_VP7 Kinase-like Pkinase_fungal RAG2 PepSY_2
Motif
Other DBs
NCBI-ProteinID: QCI86687
UniProt: A0A4D7CWI5
LinkDB All DBs
Position
complement(1440931..1442805)
Genome map
AA seq 624 aa AA seqDB search
MVEIGDKINGRYRVIRSIGSGGMANVYLAYDLILDREVAVKVLRFDFLEDETAIRRFRRE
ALAASELVHPNIVGIYDVGQEDNRQYLIMEYVHGTDLKKYIRDNYPLPTEHVIAIMQQVL
SAIGLAHEHRIIHRDLKPQNILMDEQGNVKIADFGIAIALSETSLTQTNTLLGSVHYLSP
EQARGSMATRQSDIYALGIILYELLMGKVPFEGESAVSIALKHFQSDMPSVREQYPDIPQ
SLENVILKATTKEPSDRYVSAEEMANDLLTCLLPNRANEPIFEPKSVMDDETKRLTPITD
THVQQVTQVKEPAVKRETDEMVSKLDTTEKPQKKRGRKRRVALFLVLAVLAVLAGIFFAP
SGTKVPDVSGLTVDDAITALADKGFKVSDDYQEEYSETIEKDHVIRTSPRVGTKAFKTET
IVLTVSKGSEKIEISNFIGMSLSEAKRELTSLGIEDKRITVEEVEDPDYEPGTVVSQSPA
GGSSISLEKGTVILKVSVGTEAILLDDLTGYTLTEAINYLNSQGLGFTQGSSEFSDMIPE
NSVISTSPGPGASLVKGNSVMITLSKGPEPVVEESSESVSESEIPSEPTSSSEVEVETEA
SSDEDKPSSSEEVKPDEQSDQETE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaattggtgacaaaataaacggacgttaccgagtaattcgtagcattggaagc
ggcggaatggcaaacgtatatcttgcctacgatttgattttggatcgtgaagtagcggta
aaggttttgcgatttgatttcctagaggatgaaactgcaattagaaggtttcgacgtgag
gcattagcggcatcagaattagtacatccgaatattgttggtatctatgatgttggacaa
gaagataatcgtcaatatttaattatggaatacgtccatggaactgatttgaaaaaatat
attcgagataattatccgctgccaacagaacatgtgattgcgattatgcaacaagtgtta
tcagcaattggtttagcccacgagcatcgtatcattcatcgtgacttgaagccacaaaat
attttgatggacgaacaaggtaatgtgaaaattgcagactttggtattgccattgcccta
tctgaaacatcgttaacgcaaacgaacacgttattaggttcggtacattacttatcacca
gaacaagctcgtggtagtatggcaactcgtcagtctgatatatatgctttagggataata
ttatacgaattgctaatgggaaaagtgccgtttgaaggtgaatcagctgtttccattgca
ttgaaacattttcaatctgatatgccgtcggtacgtgaacaatatcctgacattcctcaa
agtttggaaaatgttattttgaaggcaacaactaaagagccatccgatcgttatgtatcg
gcagaagaaatggccaatgatttgttgacttgtttgttacccaatcgtgcaaatgagccc
atttttgaacctaaatcagtgatggatgatgagacaaaacgtttaacaccaattacagac
acacacgtacaacaagtaacgcaagttaaagagccggctgtgaaacgtgagactgatgaa
atggtatctaagttagacacgacggagaaaccacaaaaaaaacgtggacgtaaacgacgc
gtcgccttatttttagttttagctgttttggcggtgttagctggtatcttttttgcgcca
tcaggaactaaagtcccggatgtgtcagggttaacggttgatgatgctattacagcatta
gcagataaaggttttaaagtgtcagatgattatcaagaggaatattctgaaacgattgaa
aaggatcatgtgattagaacatcacctcgtgtcggtacgaaagcttttaaaaccgagacg
attgttttgaccgttagcaaagggtctgaaaaaattgaaatcagtaattttattggtatg
agtctatcggaagctaaacgtgaattgacctcattaggaattgaagataaacgtattact
gtagaggaagtggaagatcctgattatgaacctggcacggtggtaagtcaatcaccagca
ggcggttcgagtatttccttagaaaagggtacagttatattgaaagtcagtgtggggact
gaagcgattttattagatgacttaacgggttataccttaactgaagctataaactattta
aatagtcagggtcttggtttcacacaaggttcaagtgaattttcggatatgattccagaa
aattcggttatcagtacatcacctggtccgggtgcaagtttagttaaagggaattcggtt
atgattacgttgtctaaaggaccagaaccagtagttgaagaatcaagtgagtcggtgagt
gaatcagaaataccttctgagccaacgtcatcaagcgaagtagaagttgaaacagaggca
tcatctgacgaagataaaccatcatcaagtgaagaagttaagccagatgaacaatctgat
caagagactgaataa

DBGET integrated database retrieval system