KEGG   Variovorax paradoxus S110: Vapar_0042Help
Entry
Vapar_0042        CDS       T00916                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_0042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vap02000]
    Vapar_0042
Enzymes [BR:vap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Vapar_0042
Transporters [BR:vap02000]
 Other Transporters
  Pores ion channels [TC:1]
   Vapar_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACS16705
UniProt: C5CW07
LinkDB All DBs
Position
1:complement(44670..45278)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALHEAGLAFEPVLASTKTHKLQDGTDYYGINPLGYVPMLELDDG
TRLREGPAIVQYIADLAPTKNLAPAAGTLQRYRLQEWLTFIGTEMHKGYSPLFNPNMPEE
AKAIFKDKLKSRYQWLDGQLADKQYLMGEQFSVADGYLFTVTNWAKSTGVDISGFANLQA
WHARVAARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattactcgcccggtgcctgctccctttcgccccacatcgcgctgcacgag
gcgggccttgccttcgagcccgtgctggccagcaccaagacccacaagctgcaggacggc
actgactactacggcatcaatccgctgggctacgtgcccatgctcgagctcgacgacggc
acgcgcctgcgcgaaggcccggccatcgtccagtacatcgccgacctggcccctaccaag
aacctcgcgccggccgccggcacgctgcagcgctaccgcctgcaggagtggctgaccttc
atcggcaccgagatgcacaagggctacagcccgctgttcaacccgaacatgcccgaagaa
gccaaggccatcttcaaggacaagctcaagtcgcgctatcaatggctcgacggccagctt
gccgacaagcagtatttgatgggcgagcagttcagcgtggccgacggctacctgttcacc
gtcaccaactgggccaagtccacgggcgtcgacatttcgggcttcgccaacctccaggcc
tggcatgcacgcgtggccgcccgtcccgccgttcaagcggcgatgaaggccgaaggcctg
ctgaagtaa

DBGET integrated database retrieval system