KEGG   Variovorax paradoxus S110: Vapar_0229Help
Entry
Vapar_0229        CDS       T00916                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00473  D-Alanine metabolism
vap01100  Metabolic pathways
vap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Vapar_0229
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Vapar_0229
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vap01011]
    Vapar_0229
Enzymes [BR:vap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Vapar_0229
Peptidoglycan biosynthesis and degradation proteins [BR:vap01011]
 Precursor biosynthesis
  Racemase
   Vapar_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACS16892
UniProt: C5CX88
LinkDB All DBs
Position
1:246138..247238
Genome map
AA seq 366 aa AA seqDB search
MPRPILATVHTAALRHNLDRARRAAVDARVWAVVKANAYGHGIERVYEGLRGADGFALLD
LAEAERVRALGWRGPVLLLEGVFDARDLELCSRLDLWHTVHCDEQIDMLAAHKTLKPQRV
FLKMNSGMNRLGFAPERFGSAWTRLNALPQVDEISLMTHFSDADGARGIAHQLEVFERAT
HDLLGERSIANSAATLRHARQTRGDWVRPGIVLYGSAPDFPEHDAAHWQLQPTMTLSTKL
IGIQTLKAGDTIGYGSNFTAEGPLTIGVAAVGYADGYPRHCNTGTPVLVNGVRTRMVGRV
SMDMITVDLTPVPEAKFGTEVTLWGRSAVSGAVLPIDEVAQAAGTVGYELMCAVAPRVPF
APADGE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccattctcgccactgtccacaccgccgcgcttcgccacaacctcgaccgg
gcacggcgtgccgcggtcgatgcccgcgtctgggccgtggtcaaggccaatgcctatggc
cacggcatcgagcgggtctatgagggcctgcgcggcgccgacggctttgcgctgctcgac
ctggccgaggccgagcgcgtgcgcgcccttggctggcgcggcccggtgctgctgctcgaa
ggcgtgttcgacgcgcgcgacctggagctgtgctcgcggctcgacctgtggcacacggtg
cactgcgacgagcagatcgacatgctcgcggcccacaagacgctcaagccgcagcgcgtg
ttcctcaagatgaattccggcatgaaccgcctgggcttcgcccccgagcgcttcggctcg
gcctggacccggctgaacgcgctgccccaggtcgacgagatctcgctgatgacgcatttc
agcgacgccgacggcgcacgcggcatcgcgcaccagctcgaagtgttcgagcgcgccacc
cacgacctgctgggcgaacgctccatcgccaacagcgccgccaccctgcgccatgcccgc
cagacccgcggcgactgggtgcgccccggcatcgtgctgtacggcagcgcgcccgacttt
cccgagcacgacgcggcgcactggcagctgcagcccaccatgacgctctcgaccaaactg
atcgggatccagacactgaaggcgggcgacaccatcggctacggctccaacttcacggcc
gaggggccgctcaccatcggcgtggccgcggtcggctatgccgacggctatccgcgccac
tgcaacaccggcacgccggtgctggtgaacggcgttcgcacccgcatggtgggccgcgtg
agcatggacatgatcacggtcgacctcacgcccgtgcccgaggccaagttcggcaccgag
gtcacgctctggggccgctcggccgtgagcggcgcggtgctccccatcgacgaggtcgcg
caggccgccggcaccgtcggctacgagctcatgtgcgcggtggcgccgcgcgtgcccttc
gcgccggccgacggcgaatga

DBGET integrated database retrieval system