KEGG   Variovorax paradoxus S110: Vapar_0277Help
Entry
Vapar_0277        CDS       T00916                                 

Definition
(GenBank) exodeoxyribonuclease III Xth
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
vap  Variovorax paradoxus S110
Pathway
vap03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:vap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Vapar_0277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vap03400]
    Vapar_0277
Enzymes [BR:vap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     Vapar_0277
DNA repair and recombination proteins [BR:vap03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     Vapar_0277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 Replic_Relax
Motif
Other DBs
NCBI-ProteinID: ACS16940
UniProt: C5CY36
LinkDB All DBs
Position
1:complement(297883..298686)
Genome map
AA seq 267 aa AA seqDB search
MFKLTSLNLNGLRSAATKGVADWVAELAPDCICMQEIRVQASDIEGRFEEMAGLKGHFHF
AEKKGYAGTAIYTRHAPSAVVVGWGDAEFDAEGRYLELRFDTPRRKLSIISCYFPSGSSG
EERQEAKFRFLKGFFPHLTALKKEREFILCGDINIAHKEIDLKNWRGNQKNSGFLPEERA
WMTRLLDAGADGAGLVDVYRLLKPDTTGEAYTWWSNRGQAYANNVGWRLDYHLATPALGA
LARSEQIYKTIKFSDHAPITVDYDFTL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaactgaccagcctcaatctcaatggcctgcgttcggccgccacgaagggggtg
gcggactgggtggccgaacttgcgccggattgtatttgcatgcaggagatccgggtgcag
gcgagcgacatcgaaggccgtttcgaggaaatggccggcctcaagggccatttccatttc
gccgagaaaaaaggctacgccggcaccgcgatctacacccgccacgcgccgagcgccgtg
gtggtgggctggggcgatgccgaattcgacgccgagggccgctatctcgaactgcgcttc
gacacgccccggcgcaagctctcgatcatcagctgctacttcccgagcggcagttcgggc
gaagagcggcaggaagccaagttccgcttcctgaagggcttctttccgcacctcaccgcg
ctcaagaaggagcgcgaattcatcctttgcggcgacatcaacatcgcccacaaggaaatc
gacctcaagaactggcgcggcaaccagaagaacagcggcttcctgcccgaggagcgcgcc
tggatgacccggctgctggacgccggcgccgacggcgcgggcctggtcgacgtctaccgc
ctgctcaagcccgacaccacgggcgaggcctacacctggtggagcaaccgcggccaggcc
tacgcgaacaacgtgggatggcggctggactaccacctggccacgccggccctgggcgcg
ctcgcgcgcagcgagcagatctacaagaccatcaagttcagcgaccacgcgccgatcacg
gtggactacgacttcacgctgtag

DBGET integrated database retrieval system