KEGG   Variovorax paradoxus S110: Vapar_0286Help
Entry
Vapar_0286        CDS       T00916                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00550  Peptidoglycan biosynthesis
vap01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Vapar_0286
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Vapar_0286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vap01011]
    Vapar_0286
Enzymes [BR:vap01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Vapar_0286
Peptidoglycan biosynthesis and degradation proteins [BR:vap01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Vapar_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACS16949
UniProt: C5CY45
LinkDB All DBs
Position
1:306258..308225
Genome map
AA seq 655 aa AA seqDB search
MTEIRNVAADLARFKRRVVVIGLAVLFAFSLLCARLVYLQVVRHEDLAEQAESNRTAIVP
VVPNRGLILDRNGIVLASNYSAYTLEITPSKVGDVEETIESLTQVLEISPRDRRRFKRLR
EDSRSFDSIPIRTRLSDEEVARFAAQRYRFPGVEIKARLFRNYPHAELASHVLGYIGRIN
QREKTAMEDWDEEDQANYKGTDYIGKLGIEQSYEKTLHGQTGVEQMETSAGGRAVRRLAS
HPATPGNTVMLSLDIKLQKLVEDMFGDRRGALVAIDPKSGEVLAFVSKPTFDPNLFVEGI
DTESWQALTESLDKPLLNRALRGTYPPGSTYKPFMALAALQTGKRGPNVVVNDPGYFNFG
GHRFGSPEGNIGGVDMRRSIQLSSNIYYYSLANEMGVDLIHDFMKPLGFGQITGIDLGGE
VRGVLPSTEWKRNAYKRPEQKKWYAGETISLGIGQGYNAFTMLQLAQATSIVADGGRKHK
PHLVLATRNTVSGQVVPLPQPPAENLGYSAANVAVVREGLTSVVTSGTARGVFAGAGYQA
AGKTGTAQAVTQAQNTKYNARALEEHQRDHALFMAFAPVNDPKIALAVIVENAGWGAGAA
APIARRVFDYWLMDQYPSEADMAAIKVGKATAPIGKPRVASEVAWPAASAAATAP
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatccgcaacgtcgctgccgacctcgcgcgcttcaagcgccgcgtggtcgtg
atcggcctggcggtgctgtttgccttcagcctgctgtgcgcgcggctggtgtacctgcag
gtggtgcgccacgaagacctggcggagcaggccgagagcaaccgcacggccatcgtgccc
gtggtgcccaaccgcggcctgatcctcgaccgcaacggcatcgtgctggcctccaactat
tcggcctacacgctggagatcacgccttcgaaggtgggcgacgtcgaggagaccatcgaa
agcctgacccaggtgctcgagatctcgccgcgcgaccgccgccgcttcaagcgcctgcgg
gaagactcgcgcagcttcgattccattccgatccgcacccgcctgagcgacgaggaggtc
gcgcgcttcgctgcgcagcgctaccgcttcccgggcgtggagatcaaggcccggctgttc
cgcaactacccgcacgccgagctggcctcgcacgtgcttggctacatcggccgcatcaac
cagcgcgagaagaccgcgatggaagactgggacgaggaagaccaggccaactacaagggc
accgactacatcggcaagctcggcatcgagcagagctacgagaagacgctgcacggccag
accggcgtcgagcaaatggaaacctcggccggcggccgcgcggtgcgccggctcgccagc
cacccggccacgcccggcaacaccgtgatgctgtcgctcgacatcaagctgcagaagctg
gtggaagacatgttcggcgaccgccgcggcgcgctggtggccatcgaccccaagtccggc
gaggtgctggccttcgtgagcaagcccaccttcgaccccaacctgttcgtcgaaggcatc
gacaccgagagctggcaggcgctgaccgaatcgctcgacaagccgcttttgaaccgcgcg
ctgcgcggcacctacccgcccggctccacctacaagcccttcatggcgcttgcggcgctg
cagaccggcaagcgcggccccaacgtggtggtgaacgatcctggctacttcaacttcggc
ggccaccgcttcggcagccccgagggcaacatcggcggcgtcgacatgcgccgctcgatc
cagctgtcgagcaacatctactactactcgctggccaatgaaatgggcgtggacctgatc
cacgacttcatgaagccgctgggcttcggccagatcaccggcatcgacctgggcggcgag
gtgcgcggcgtgctgccgagcaccgagtggaagcgcaacgcctacaagcggcccgagcag
aagaagtggtatgcgggcgagaccatctcgctgggcatcgggcagggctacaacgccttc
acgatgctgcagctcgcgcaggccacctccatcgtggccgacggtggccgcaagcacaag
ccgcacctcgtgctggccacgcgcaacaccgtgagcgggcaggtggtgccgctgccccag
ccgccggccgagaacctgggctattccgcggccaacgtcgcggtggtccgcgagggcctg
accagcgtggtcaccagcggcactgcgcgcggcgtgttcgccggcgcgggctaccaagcg
gccggcaagaccggcaccgcgcaggccgtgacgcaggcgcagaacaccaagtacaacgcg
cgcgcgctcgaggagcaccagcgcgaccacgcgctgttcatggcctttgcgccggtcaac
gatccgaagatcgcgctcgcggtgatcgtcgagaacgccggctggggcgcaggcgcggcg
gcgcccattgcgcgccgcgtgttcgactactggctgatggaccagtatccgagcgaggcc
gacatggccgccatcaaggtcggcaaggccaccgccccgatcggcaagccgcgcgtggcc
agcgaagtggcttggccggcagcgtcggccgccgcaaccgcaccctga

DBGET integrated database retrieval system