KEGG   Variovorax paradoxus S110: Vapar_0341Help
Entry
Vapar_0341        CDS       T00916                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Vapar_0341
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Vapar_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAM72 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACS17004
UniProt: C5CYA0
LinkDB All DBs
Position
1:complement(367312..368451)
Genome map
AA seq 379 aa AA seqDB search
MSYQKLQPGASGAIGQLAAMQAVVCHGPKDYRLETVAMPGIGPNELLISIAACGICASDC
KCHSGAKMFWGGDGQPSWVKAPVIPGHEFFGYVEALGEGAAEHFGVEKGDRVIAEQIVPC
GKCRFCTSGKYWMCEVHNIFGFQRIVADGGMADYMRLPPTSRVHRIPDGISLEDAAIIEP
LSCAIHTVNRGDIQLDDVVVIAGAGPLGLMMVQAAHLKTPKKLIVIDLVPERLALAKKFG
ADVTIDARTENADAIVKGLTEGYGCDVYIETTGAPIGVTQGLEMIRKLGRFVEFSVFGSE
TSADWSIIGDRKELDVRGAHLGPYCYPIAIDLLARGLVTSKGIVTHDFPLTEWERAFTLA
NSLDSIKVLLKPQPRATTS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcaaaagctccagcccggcgcatcgggcgccatcggccaactcgccgccatg
caggccgtcgtctgccacggccccaaggactaccggctcgaaaccgtcgcgatgcccggc
atcggcccgaacgagctgctgatctccattgcggcctgcggcatctgcgcttccgactgc
aagtgccactcgggcgcgaagatgttctggggcggcgacggccagccttcgtgggtcaag
gcgccggtgattcccggccatgaattcttcggttatgtcgaagcgctcggcgaaggcgcg
gccgagcacttcggcgtggaaaaaggcgaccgcgtgatcgccgagcagatcgtgccctgc
ggcaagtgccgcttctgcacctcgggcaagtactggatgtgcgaggtgcacaacatcttc
ggcttccagcgcatcgtggccgacggcggcatggccgactacatgcggctgccgccgacc
tcgcgcgtgcacaggatcccggacggcatctcgctggaagacgccgccatcatcgagccg
ctctcgtgcgcgatccacacggtgaaccggggcgacatccagttggacgacgtggtggtg
atcgccggcgccggcccgctcgggctgatgatggtgcaggccgcgcacctgaagacgccg
aagaagctgatcgtgatcgacctcgtgcccgagcgcctcgcactggccaagaagtttggc
gccgacgtgacgatcgatgccaggaccgagaacgccgacgccatcgtcaagggcctgacc
gagggctacggctgcgacgtgtacatcgagaccacgggcgcgcccatcggcgtgacgcag
gggctggagatgatccgcaagctcggccgcttcgtcgagttcagcgtgttcggctcggag
accagcgccgactggtcgatcatcggggaccgcaaggaactcgacgtgcgcggcgcgcac
ctggggccctactgctacccgattgccatcgacctgctggcgcgcgggctcgtcacctcg
aagggcatcgtgacgcacgacttcccgttgaccgagtgggagcgcgccttcacactggcc
aactcgctcgattccatcaaggtgctgctcaagccgcagccgcgggcaacaacatcatga

DBGET integrated database retrieval system