KEGG   Variovorax paradoxus S110: Vapar_1814Help
Entry
Vapar_1814        CDS       T00916                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Vapar_1814
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Vapar_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored Glutaredoxin FAD_binding_2 HI0933_like FAD_binding_3 DAO AlaDh_PNT_C Thi4 NAD_binding_7 FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACS18464
UniProt: C5CUN6
LinkDB All DBs
Position
1:1947960..1949531
Genome map
AA seq 523 aa AA seqDB search
MLDASTKAQLKSYLERATQPIEIVASLDDSKASGEMLSLLKDVAEASPLVKLTESRDDNH
RKPSFSVNRPSENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQAVLDQIRALDGDFE
FEIYVSLTCHNCPDVVQALNLMAIQNPRIRTTMIEGGTFQEEVKERQVMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEREAKKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGKDLI
EVQLESGASLKSKSIIISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDTQLRADAVLQRKLKSLKNVDVFTNAQTTEITGDQKV
NGLVYKDRATGELKKVELEGVFIQIGLVPNTDWLKGVVELTKHGEIVVDARGQTSVPGVF
AAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPAEQAAQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcaccaaagcccaattgaagagttacctcgaacgcgccacgcagccg
atcgagatcgtcgcctcgctcgacgacagcaaggcctcgggcgaaatgctgtcgctgctg
aaggacgtcgccgaagcgtcgccgctggtcaagctgaccgaaagccgcgacgacaaccat
cgcaagccctctttctcggtcaaccgtccgagcgagaaccacggcccgcgttttgccggc
ctgccgatgggccatgaattcacctcgctgatccttgcactgctgcagatcggcggctat
cccccgaaggtcgagcaggcggtgctcgaccagatccgcgcgctcgacggcgacttcgag
ttcgagatctacgtttcgctcacctgccacaactgccccgatgtggtccaggccctgaac
ctgatggccatccagaacccgcgcatccgcaccaccatgatcgagggcggcaccttccag
gaagaggtcaaggaacgccaggtgatggccgtgcccaccgtgttcctgaacggcaccgag
ttcggccagggccgcatgagcctggaagagatcctcgcgaagatcgacaccagcggtgtc
gagcgcgaagcgaagaagatcgccgccaaggacccgttcgacgtgctgatcgtcggcggc
ggcccggccggcgcggcggcggccgtgtatgcggcgcgcaagggcatccgcaccggcgtg
gcctcggagcgctttggcggccaggtgctcgacacgctgggcatcgagaacttcatctcg
atcaaggaaaccgaaggaccgaagttcgcccacgccctcgaagagcatgtgcgcgactac
gacgtcgacatcatgaacctgcagcgcgccaaggcgctggttccgggcaaggacctgatc
gaggtgcaactggagagcggcgcttcgctcaagagcaaatcgatcatcatctcgaccggc
gcgcgctggcgcaacatcaacgtgccgggcgagcacgagttcaagaacaagggcgtggcc
tactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggtggc
ggcaattcgggcgtcgaagcggccatcgacctggccggcatcgtcggccatgtcacgctg
atcgagttcgacacgcagctgcgcgccgacgccgtgctgcagcgcaagctcaagagcctg
aagaacgtcgacgtgttcaccaacgcgcagaccaccgagatcaccggcgaccagaaggtc
aacggcctggtctacaaggaccgcgcgacgggcgagctgaagaaggtcgaactcgaaggc
gtgttcatccagatcggcctggtgcccaacaccgactggctcaagggcgtggtcgagctg
acaaagcacggcgagatcgtggtcgacgccaggggccagacctcggtaccgggcgtgttt
gccgcgggcgacgtgacgaccgtgccgttcaagcagatcatcatcgcggccggcgacggg
gcgaaggcggcgctcggcgccttcgatcacctgatccggacctcggccccggccgagcag
gcggctcagtaa

DBGET integrated database retrieval system