KEGG   Variovorax paradoxus S110: Vapar_1968Help
Entry
Vapar_1968        CDS       T00916                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00500  Starch and sucrose metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Vapar_1968
Enzymes [BR:vap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Vapar_1968
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Vapar_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ACS18614
UniProt: C5CVG5
LinkDB All DBs
Position
1:complement(2107331..2108995)
Genome map
AA seq 554 aa AA seqDB search
MINDLWYKNAVVYCLSVGTFMDSNGDGCGDFEGLTRRLEYLHGLGVTTLWLMPFHPSPRQ
DDGYDVSDFYNVDPRFGTLGDFVEFTHSASRLGMRVLMDLVVNHTSDQHPWFQQARRDRK
SKYHNWYVWSDRKPARYTDGVVFPGVQKSTWTFDKLARRWYFHRFYEFQPDLNTANPDVQ
AEILKIMGFWTQMGVSGFRMDAVPFVIGAKGPRVVRPTEKFDMLRQFRELLQWRRGDAII
LAEANVLPSTNMAYFGDEGERLHMMFNFQVNQHLFYAMAVADARPLAKALEATRARPATS
QWGIFLRNHDELDLGRLRPAQRQRVFAAFGPEKDMQLYDRGIRRRLAPMLGGNRRRLELA
YSLMLTLPGTPVVRYGDEIGMGDDLSLPERNCARTPMQWSTERQGGFTTSSKPVLPVITG
GAYGFEHVNVAAQRRDPESLLNWMERVFRMRKEVPEIGWGDFEVVPNEERAVLVMRYEWR
GNAAVFVHNLGDSPLEIKLGAKALGRHGGQLINLLSNAHSRANSKGKHCMLLEPYGYRWF
RVGPLDYLLKREEM
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgacctttggtacaaaaacgccgtggtgtattgcctctccgtgggaaccttc
atggactccaacggcgatggctgcggcgacttcgaggggctgacacggcggctggagtac
cttcacggcctgggtgtcacgaccctgtggctgatgcccttccatccatcgccgaggcag
gacgacggctacgatgtttcggacttttacaacgtcgatccccgcttcggcacgctcggc
gatttcgtcgagttcacgcactcggcttcgcgccttggcatgcgcgtgctgatggacctg
gtggtgaaccacacctcggaccagcacccgtggttccagcaggcacgcagggaccgcaag
tcaaagtatcacaactggtatgtgtggtccgacaggaagccggcccgctacaccgatggt
gtggtcttcccgggcgtgcagaaatcgacctggaccttcgacaagctcgcaaggcgctgg
tacttccaccgcttctacgaattccagcccgacctgaacaccgccaaccccgacgtgcag
gccgagatcctgaagatcatgggcttctggacccagatgggcgtctcgggtttccgcatg
gacgccgtgcccttcgtgatcggcgccaagggcccgagggtggtgcgcccgaccgagaag
ttcgacatgctgcggcagttccgcgaactgctccagtggcgccggggcgacgcgatcatc
ctcgccgaggccaacgtgctgcccagcaccaacatggcctacttcggcgacgagggcgag
cggctgcacatgatgttcaacttccaggtcaaccagcacctcttctatgcgatggccgtg
gccgacgcgcggccgctggccaaggcgctggaggcgacccgggcgcgccccgcgacctcg
cagtggggcatcttcctgcgcaaccacgacgagctcgacctgggccgcctgcggcccgca
cagcgccagcgcgtgttcgccgccttcggccccgaaaaggacatgcagctgtacgaccgc
ggcatacgccgcaggctggcaccgatgctcggcggcaaccggcggcgcctcgagctggcc
tacagcctgatgctcaccctgcccggcacgccggtggtccgctacggcgacgagatcggc
atgggcgacgacctgagcctgccggagcgcaactgcgcgcgcacgccgatgcagtggtcc
accgagcgccagggcgggttcaccacctcttccaagccggtgctgccggtgatcacgggt
ggtgcctacggcttcgagcatgtgaacgtggcggcgcagcggcgcgaccccgagtcgctg
ctcaactggatggaacgcgtgttccgcatgcgaaaggaagtgcccgagatcggctggggc
gacttcgaggtggttcccaacgaggagcgcgcggtgctcgtcatgcgctacgaatggcgc
ggcaacgcggcggtcttcgtgcacaacctgggcgacagcccgctggaaataaagctcggc
gccaaggcgctcggcaggcacggcgggcagctgatcaacctgctctccaacgcgcacagc
cgcgccaactcgaagggaaagcactgcatgctgctggagccctacggctaccggtggttc
cgcgtcggcccgctcgactatcttctcaagcgcgaggagatgtga

DBGET integrated database retrieval system