KEGG   Variovorax paradoxus S110: Vapar_2172Help
Entry
Vapar_2172        CDS       T00916                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00020  Citrate cycle (TCA cycle)
vap00310  Lysine degradation
vap00380  Tryptophan metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
Module
vap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_2172
  09105 Amino acid metabolism
   00310 Lysine degradation
    Vapar_2172
   00380 Tryptophan metabolism
    Vapar_2172
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Vapar_2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACS18807
UniProt: C5CXF1
LinkDB All DBs
Position
1:2322054..2323313
Genome map
AA seq 419 aa AA seqDB search
MSIVEVKVPQLSESVAEATMLTWKKKAGEAVAVDEILIEIETDKVVLEVPAPSAGVLAEI
VQPDGATVVADQLIAKIDTEGKASAAAPAAAAPAAAPAPAAAPAAAAAATGGSKSDVAMP
AAAKLLADNNLKTSDVAGSGKDGRVTKGDVLGAVASGAKPAPAVAAPAAKPALPQVAAPA
GAPDLGERPEQRVPMSRLRARIAERLIQSQSTNAILTTFNEVNMAPVMELRKRFQDSFTK
EHGVKLGFMSFFVKAAVHALKKYPVINASVDGNDILYHGYFDIGIAVGSPRGLVVPILRN
ADQMSFADIEKKIAEYGKKAQDGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPSRLLFDI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgtagaagtcaaagtcccccagctttccgaatccgtggccgaagccaccatg
ctcacctggaagaagaaggccggcgaagccgtcgccgtcgatgaaatcctgatcgagatc
gagaccgacaaggtcgtgctcgaggtgcccgcgccctcggctggcgtgctggccgagatc
gtgcagcccgatggcgccaccgtggtggccgaccagctgatcgcgaagatcgacaccgaa
ggcaaggcaagcgctgcagcgcctgcagcagcggcacccgccgccgcaccggccccggca
gctgcgcccgcagcggctgcggccgccaccggcggttcgaagtccgacgttgccatgccc
gccgccgccaagctgctggccgacaacaacctgaagaccagcgacgtggccggcagcggc
aaggacggccgcgtcaccaagggcgacgtgctcggcgccgtggcttcgggcgccaagccc
gcgcccgccgtggctgcaccggccgccaagcccgcgctgccgcaagtcgccgcgcccgcg
ggtgcgcccgacctgggcgagcgccccgagcagcgcgtgccgatgagccgcctgcgcgcc
cgcatcgccgagcgcctgatccagtcgcaatcgaccaacgcgatcctgacgaccttcaat
gaagtcaacatggcgcccgtcatggagctgcgcaagcgcttccaggacagcttcaccaag
gagcatggcgtgaagctcggcttcatgagcttcttcgtgaaggccgcggtgcatgcgctc
aagaagtacccggtgatcaacgcctcggtcgacggcaacgacatcctgtaccacggctac
ttcgacatcggcattgccgtcggttcgccgcgcggcctggtggtgccgatcctgcgcaac
gccgaccagatgagctttgccgacatcgagaagaagatcgccgaatacggcaagaaggca
caggacggcaagctcggcatcgaagagatgaccggcggcaccttctccatctcgaacggc
ggcaccttcggctcgatgctctcgacgccgatcatcaacccgccccagtcggccatcctc
ggcgtgcacgccaccaaggaccgcgccgtggtcgagaacggccagatcgtggttcgcccg
atgaactaccttgccatgagctacgaccaccgcatcatcgacggccgcgaagccgtgctg
ggcctggtggccatgaaggaagcgctcgaagacccgtcgcgcctgctgttcgacatctga

DBGET integrated database retrieval system