KEGG   Variovorax paradoxus S110: Vapar_2879Help
Entry
Vapar_2879        CDS       T00916                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Vapar_2879
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Vapar_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Methyltransf_25 ADH_zinc_N_2 TTc_toxin_rep 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: ACS19499
UniProt: C5CMY7
LinkDB All DBs
Position
1:3026417..3027454
Genome map
AA seq 345 aa AA seqDB search
MLNCEIHGALDLRLAERPAEPLAPTQVRVAVKAVGICGSDLHYYRHGRVGDFVIRAPLTP
GHEASGQVIEVGAQVSSVKPGDRVALNPSRTCGVCRFCRAGASNHCENVHFFGSASRWPH
MQGAMREQVVVEATQCLIVPDTLSFELAAFGEPLAVALHAVQEAGSLLGKTVMVVGAGPI
GALILMAAKLAGASQLIAVDIVDETLAACTRVGATRTINAATQPDALQALAADKGQVDAC
FEVSGHYGGLANCIRSTRPRGTIVQVGTLGGHSEGCPFNQVMVKSLHLVGSFRFVDEYAW
AVDYLSRGLLDVSPLLTEAVPVARVHDAFALAADRHRAMKVLVTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactgcgaaatccacggcgcgctcgacctgcgccttgccgaacgcccggccgaa
ccgctggcgcccacccaggtgcgcgtggccgtcaaggcggtcggcatctgcggctccgac
ctgcactactaccgccacggccgcgtcggcgacttcgtcatccgcgcaccgctgacgccg
gggcacgaggcctcgggccaggtcatcgaagtgggcgcgcaggtgagctcggtgaagccg
ggcgaccgcgtggccctcaacccgtcgcgcacctgcggcgtctgccgcttctgccgcgcg
ggcgcttccaaccactgcgagaacgtgcacttcttcggcagcgccagccgctggccccac
atgcagggcgcgatgcgcgagcaggtggtggtggaggccacgcagtgcctcatcgtgccc
gacacgctgtcgttcgagctggccgccttcggcgagccgctggcggtggcactgcatgcg
gtgcaggaggccggctcgctgctcggcaagacagtgatggtggtgggcgcggggccgatc
ggcgcactgatcctcatggccgcgaagctcgcgggcgcgagccagctgattgcggtggac
atcgtggacgagacgctcgcggcctgcacccgcgtcggcgcgacgcgcaccatcaacgcg
gccacgcagcccgatgcgctgcaggcattggccgcggacaagggccaggtcgatgcgtgc
ttcgaggtttcgggccactacggcggcctggccaattgcatccggtcgacgcgcccgcgc
ggcaccatcgtgcaggtgggcacgctcggcggccacagcgagggctgcccgttcaaccag
gtcatggtcaagagcctgcacctggtcggcagcttccgcttcgtcgacgaatacgcctgg
gcggtggactacctgagccgcggcctgctggacgtgtcgcccctgctgaccgaggcggtg
ccggtggcacgcgtgcacgacgccttcgcgctggcggcggaccggcaccgcgcgatgaag
gtgctcgtcacgttctga

DBGET integrated database retrieval system