KEGG   Variovorax paradoxus S110: Vapar_3031Help
Entry
Vapar_3031        CDS       T00916                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00630  Glyoxylate and dicarboxylate metabolism
vap00710  Carbon fixation in photosynthetic organisms
vap01100  Metabolic pathways
vap01120  Microbial metabolism in diverse environments
vap01200  Carbon metabolism
Module
vap_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vap_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Vapar_3031
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Vapar_3031
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Vapar_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small DUF772
Motif
Other DBs
NCBI-ProteinID: ACS19650
UniProt: C5CPR1
LinkDB All DBs
Position
1:complement(3189240..3189659)
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLSDEQISRQVEYCLGKGWAIGLEYTDDPHPRNTFWEMFGNPMFDIKD
AAGVMLELAACRKTFPQQYIRVTAFDSTHGTESVVMSFIVNRPSNEPGFRLIRTEEPGRT
IRYSLESYAVQARPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcacacaaggcaccttttccttcctgcccgacctgagcgacgagcagatcagc
cgccaggtcgagtattgcctgggcaagggctgggccatcggcctcgaatacaccgacgac
ccgcatccgcgcaacaccttctgggagatgttcggcaacccgatgttcgacatcaaggat
gcggccggcgtgatgctcgaactcgcggcctgccgcaagacctttccgcagcaatacatc
cgcgtgacggccttcgattcgacgcacggcaccgagtcggtcgtgatgtccttcattgtc
aaccggccgtcgaacgaaccgggcttccgcctgatccgcaccgaggagccgggccgcacg
atccgctacagcctcgaaagctatgcggtgcaggcgcggcccgaaggcagccgctactga

DBGET integrated database retrieval system