KEGG   Variovorax paradoxus S110: Vapar_5142Help
Entry
Vapar_5142        CDS       T00916                                 

Definition
(GenBank) Hydroxypyruvate isomerase
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Vapar_5142
Enzymes [BR:vap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     Vapar_5142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACS21744
UniProt: C5CR68
LinkDB All DBs
Position
1:complement(5455959..5456777)
Genome map
AA seq 272 aa AA seqDB search
MPQFAANLSMLYPELDFLDRFEAAAKDGFKAVEYLFPYAFAKEELAARLQHNGLQQVLFN
APPGDWDRGERGLACLPGRDAEFREGMASAIDYAVALGCPRIHVMAGLVPEGLEREAVQP
VYVDNLRWAAAEAAKAGRDVLIEPINTRDIPRFFLNRQDHAHEIVDMVGATNLKVQMDLY
HCQIVEGDVAMKIRKYLPTGRVGHIQIAGVPERHEPDIGEQNYPYLFDLIDEVSAQSGWQ
GWVGCEYRPRRGSEPGGTSAGLGWLRALQQRA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccccaattcgccgccaacctctcgatgctctatccggagctcgacttcctcgaccgc
ttcgaagccgccgcgaaagacggcttcaaggccgtcgaatatctttttccctatgccttc
gcaaaggaagagctcgccgcgcggctccagcacaacggcctgcagcaggtgctcttcaac
gcccctccgggcgactgggaccgcggcgagcgcggcctggcctgcctgccgggccgcgac
gccgaattccgcgaaggcatggccagcgccatcgactacgccgtggcgctcggctgcccg
cgcatccacgtcatggcgggcctggtgcccgaaggcctggagcgcgaggccgtgcagccc
gtgtacgtcgacaacctgcgctgggccgcggccgaggcggccaaggccgggcgcgacgtg
ctgatcgagcccatcaacacgcgcgacatcccgcgcttcttcctcaaccggcaggaccat
gcgcacgagatcgtcgacatggtgggcgcgaccaacctcaaggtgcagatggacctgtac
cactgccagatcgtcgagggtgacgtggccatgaagatccgcaagtacctgcccaccggg
cgcgtgggccacatccagattgccggcgtgcccgagcgccacgagcccgacatcggcgag
cagaactacccctacctgttcgacctgatcgacgaggtgtcggcgcagtccggctggcag
ggctgggtcggctgcgagtaccggccccggcgcggctcggaacccggcggcacctcggcg
gggctcggctggctgcgagcgctgcaacagcgcgcatga

DBGET integrated database retrieval system