KEGG   Vigna angularis (adzuki bean): 108320254Help
Entry
108320254         CDS       T04660                                 

Definition
(RefSeq) probable glutathione S-transferase parC
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108320254
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:var02000]
    108320254
Enzymes [BR:var01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108320254
Transporters [BR:var02000]
 Other Transporters
  Pores ion channels [TC:1]
   108320254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_C GST_N_2 GST_C_3 GST_C_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 108320254
NCBI-ProteinID: XP_017407128
UniProt: A0A0L9T8X6
LinkDB All DBs
Position
Un
AA seq 219 aa AA seqDB search
MAEELILLDDWLSMYGMRARIALAEKEIKYEYREEDLGNKTQLLLQMNPIHKKIPVLIHS
GKPICESIIIVEYIDELWKNKGSFLPSDPYERAQARFWADFVNKKIGDVGWRIWAGKREG
IDEAKKEFVEALKELEKELGEKAYFGGDTFGFVDIALISFSTWFYTFEALGNFKVKTESP
KIIAWAERCNQRESVSKSLAPEKDVYDFVLSYRQSNHLD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagttgattctgttggatgactggctgagtatgtacggcatgagagcaagg
atagcacttgcagagaaggagataaagtatgaatacagagaagaggatctgggaaacaaa
acccaactgcttctgcaaatgaacccaattcacaagaagattccagttctcatccacagt
ggtaaacccatatgtgagtccatcattattgttgagtatattgatgagctttggaagaac
aaaggctctttcttaccctcagatccttacgagagagctcaggccaggttctgggctgat
tttgtcaacaaaaagataggtgatgttgggtggaggatatgggcaggaaagagagaaggg
attgacgaggcaaagaaagagtttgtggaggccttaaaggaactggagaaggagcttgga
gagaaggcttactttgggggagacacatttggatttgttgacattgctctcatctctttc
tccacctggttttacacttttgaggcattggggaatttcaaagtgaagacagagtctcct
aagatcattgcttgggctgagagatgcaatcagagggaaagtgtttccaaatctcttgct
cctgagaaggacgtctatgactttgttctaagctacagacagagcaatcacttggactaa

DBGET integrated database retrieval system