KEGG   Vigna angularis (adzuki bean): 108321698Help
Entry
108321698         CDS       T04660                                 

Definition
(RefSeq) DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var03030  DNA replication
var03410  Base excision repair
var03420  Nucleotide excision repair
var03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:var00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108321698
   03410 Base excision repair
    108321698
   03420 Nucleotide excision repair
    108321698
   03430 Mismatch repair
    108321698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:var03032]
    108321698
   03400 DNA repair and recombination proteins [BR:var03400]
    108321698
Enzymes [BR:var01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108321698
    6.5.1.6  DNA ligase (ATP or NAD+)
     108321698
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108321698
DNA replication proteins [BR:var03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108321698
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108321698
DNA repair and recombination proteins [BR:var03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108321698
   NER (nucleotide excision repair)
    Other NER factors
     108321698
   MMR (mismatch excision repair)
    Other MMR factors
     108321698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 108321698
NCBI-ProteinID: XP_017409015
LinkDB All DBs
Position
Un
AA seq 1402 aa AA seqDB search
MDSETLDSTQLFLTALKTLQPDPPPPASTSLSPFPSSLPHSKLIPHTRFLVDAFRHAGPY
SHSYFLSHFHSDHYTGLSASWSRGVIFCSATTASLLRNILHVPAALVVPLPLRQTLCIDG
AQVTLLDANHCPGAVQFLFAIPCADGTAALRYVHTGDFRFSSSMVSEPALASFVGADAVF
LDTTYCNPKFVFPSQEESIDYVASVVERVERECGDSNDKVLFLVATYVIGKEKILLELAR
RFKRKIHVDARKMEVLRVLGYGESGEFTENGLESNIHVVGWNVLGETWPYFRPNFVKMKE
VMAERGGSYSRVVGFVPTGWTYEVKRSRFAVKCKDSFQIHLVPYSEHSNYDELREYVKFL
KPKRVVPTVGLDVEKSDSKHANRIMKHFAGLVDETANKHEFLRGFCRGLGEVGFKAEKGV
SDVLEPGQGMGKEVIPLEEVEGDKSIDPGVAVGLHSFMGDTCTEDPTLLTDEEKEKIIRE
LSCSLPTWVTRDQMLDMISISGSNVVEAVSNFYERETEFHEQVISCQTPVSTSKCCTLND
TDSFAKPSLNNANNTSKNINIFPSQDSKSTILRHKLPSPVSPAKRKRSSGSKPNKKGKVK
AKSEPSDSKQSTLTRFFKKVIPEIPGGTQSDNSEPKLEQSSEVEDLLPTDVGQIYKDEID
QFLQIINGNESLKNHAMTIIKKTKGDVNKALDIYYCNSGNLSENELSVQEESQIDRPLVK
KHASEELRIMPDISGQKVLKDNVDATQLSLPPEKYNPIEHACWRDGQPAPYLHIARTFNL
LEGERGKIKATSLLCNMFRSLLALSPADVLPAVYLCTNKIAADHENKELNIGGSLVTAAL
EEACGTNRLKIREMYNKFGDLGDVAQECRQTQRLLAPPTPLLIKDVFSALQKISVQTGNG
SISRKKGIIVHLMHSCREKEMKFLVRTLVRNLRIGAMLRTVLPALAHAVAMNSSPTFHQG
GTAENLKEKLQVHSAVLSMAVVEAYNILPNLDLIVPSLMNKGIDFSVSSLSMVPGIPIKP
MLAKITNGIPQALKLFENKAFTCEYKYDGQRAQIHKLVDGSIRVFSRNGDETTSRFPDLI
DIIKESSKPVASTFVMDAEVVGIDRKNGCRIMSFQELSSRGRGGKDALVTAESIKVDICI
FVFDIMFANGEQLLGFPLRLRRKYLKDLFYDEKPGYFEYAKETTIEADDACLACEATLTK
INTFLEEAIHSSCEGIMVKTLDVEAGYFPSKRSDKWLKVKRDYVEGLNDTLDLVPIGAWH
GNGRKAGWYSPFLVACFNPETEEYQSVCRVMSGFSDSFYIEMKEFFSGDKVLSKKPPYYQ
TGEAPDIWFCPQVVWEIKGADFTVSPVHHAAIGLVHPSRGISIRFPRFICCVSDRNPEEC
STASDIVEMFHSQTRKMDVTAK
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggattctgaaaccctagactccacccagctgttcctcacagccctcaaaaccctccaa
cccgaccctcctcctccagcctccacctccctctccccattcccctcctccctccctcac
tccaaacttatcccccacacacgcttcctcgtcgacgccttccgccacgccggcccctac
tcccactcctacttcctctcccacttccactccgaccactacaccggcctctccgcctcc
tggtcccgcggcgtcatcttctgctccgccaccaccgcctctctcctccgcaacatcctc
cacgtccccgctgccctcgtcgtccctcttcccctccgccaaaccctttgcattgatggc
gcccaagtcaccctcctcgacgccaaccactgccccggcgccgtacagttcctcttcgcc
atcccctgcgccgatggcaccgccgccctaaggtacgttcacactggcgacttccgtttt
tctagttccatggtttcggagcccgccctcgcctccttcgtcggtgccgatgcggttttt
ctcgacacgacatattgtaatcctaagttcgttttcccctcgcaagaggaatctattgat
tacgttgccagtgttgtggagagggttgagcgtgagtgtggtgatagtaatgataaagtt
ctatttcttgttgctacttatgttattgggaaggagaagattttgcttgagcttgcacgt
agatttaagaggaagatacatgttgatgctaggaagatggaggttttgagggttcttggg
tatggggagagcggtgagtttactgagaatgggttggagagtaatattcatgttgttggg
tggaatgtgttgggggagacttggccatactttaggcctaattttgttaagatgaaggag
gttatggctgaaagagggggttcctactccagggttgtgggctttgttcctaccggctgg
acctatgaggtgaagcgcagtaggtttgcagtcaagtgcaaggattcatttcagattcat
cttgtgccctatagtgagcactcgaactatgatgagctcagggagtatgtgaagtttttg
aagccaaagcgggttgttccgactgtgggtttggatgttgagaagagtgacagtaaacat
gctaacagaattatgaagcactttgccgggttagttgatgagactgctaacaagcatgag
tttttaagggggttttgccgtggccttggtgaagtgggtttcaaggctgagaagggtgtt
agtgatgttctggaaccaggtcaaggcatgggcaaggaagtcattccattggaggaggta
gaaggtgataagagtattgatccaggtgtggctgtgggtttgcattcttttatgggagat
acttgtacagaagatcctactttgctgaccgatgaagaaaaagagaaaataattcgagaa
cttagttgtagtttacccacgtgggtcacccgagaccagatgctggatatgatcagcatc
tctgggagtaatgtcgttgaagctgtttctaatttctatgaacgtgaaactgaatttcac
gagcaagtgatttcctgtcaaactcctgtttcaacatccaagtgctgcacattaaatgac
actgattcatttgcaaaacctagccttaataatgcaaacaacactagcaaaaatattaac
atttttcctagtcaagactctaaatcaactatcctgaggcataaactacctagtcccgtt
tctcctgccaaaaggaagagaagtagtggcagtaagccaaacaaaaaaggcaaagtcaaa
gcaaaatccgaaccaagtgattcaaagcagtccacacttacaagattcttcaagaaagta
atacctgagattcctggtggtactcaatctgataattctgaaccaaagcttgaacaaagc
tctgaagttgaagacttgttgccaactgatgttggacaaatttacaaggatgaaattgat
caatttttgcagataataaatgggaatgagtcattaaagaaccatgccatgactataatt
aagaagacaaaaggagatgtcaataaagcactggatatatattactgtaattctggaaat
cttagcgaaaatgaattatcagttcaagaggagagccaaattgatagaccattagtaaag
aaacatgcatcagaggaattaagaattatgccagatatttctgggcagaaagtgttaaaa
gataatgtagatgctactcaactatctctaccaccagagaaatacaatcctatagaacat
gcatgttggagagatggacagcctgcaccatatttacatattgcgcgaaccttcaacctg
cttgagggtgagagaggaaagattaaagctacttcattgttatgcaatatgtttagaagt
ttgttggctttatctccagcagatgtgcttcctgctgtgtatctatgcacaaacaaaatt
gctgcagatcatgaaaataaggaattaaatattggtggaagtttagtcactgcagcactt
gaagaggcgtgtggaacaaatcgtttgaaaatacgggagatgtataacaaatttggtgat
ctcggtgatgttgctcaagaatgtcgtcaaacacagagattacttgcaccacctacacca
cttctaattaaggatgttttctctgcactacaaaagataagtgtacaaacaggcaatgga
agtatatctcgcaagaaaggcatcattgttcatctcatgcactcctgccgagagaaggag
atgaagtttcttgttcggaccttggttaggaacttaaggattggggccatgcttagaact
gttttgcctgcattggctcatgctgttgctatgaattctagccctacttttcaccaagga
ggaactgcagaaaatttgaaggagaagcttcaggtccattcagcagttctttctatggca
gttgttgaagcatataacatactgccaaatctggatctaatagttccatctctcatgaac
aaaggcattgatttttcggtttcaagtttatcaatggttccaggaataccaattaagcct
atgctagcaaagatcaccaatggtattcctcaagcactgaagctatttgaaaataaagca
tttacatgtgaatataagtatgatggtcagcgggcccaaattcacaagttagttgatgga
tcgattcgtgttttttctagaaatggggacgaaacaacttcaagatttcctgatctgatt
gacataatcaaggaatccagcaagcctgttgcatcaacttttgtaatggatgcggaagtt
gttggtatagacaggaaaaatggatgcaggattatgtctttccaggagctatcatcacgt
gggagaggtggaaaagatgcgttagttacagcagagagcatcaaggtggatatatgcatc
tttgtctttgatataatgttcgcaaacggagagcagttattgggttttcctctacgcctt
agacgaaagtatctgaaggatttattctatgatgagaaacctgggtattttgaatatgca
aaggaaacaactattgaagcagatgatgcttgcttagcttgcgaagccacattaactaag
ataaatactttcctggaagaggcaatccactcttcatgcgaaggaattatggtgaaaaca
ttggatgttgaggctggctattttccatcaaagcgttctgataaatggttaaaagtcaag
cgagattatgtggaaggattaaatgatactcttgatttagtaccgattggtgcttggcat
ggaaatggaaggaaagctggatggtatagtccatttcttgtggcgtgtttcaatccggaa
acagaggagtaccaaagtgtatgtcgtgtgatgtctggattctcagattcattttatata
gagatgaaagaattcttctctggggacaaagtattgtccaaaaaaccgccatattatcaa
acaggagaggcaccagacatttggttttgtccacaagtcgtttgggaaataaaaggagca
gactttacagtatccccagttcatcatgctgcaattggtttagttcatccatctcgtggc
atttcaatcagatttccaagatttatttgctgtgtctcagacagaaacccagaagaatgt
agcacagcttccgatatagttgaaatgtttcattctcagactcggaagatggatgtcacg
gctaaatag

DBGET integrated database retrieval system