KEGG   Vigna angularis (adzuki bean): 108322143Help
Entry
108322143         CDS       T04660                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00630  Glyoxylate and dicarboxylate metabolism
var00710  Carbon fixation in photosynthetic organisms
var01100  Metabolic pathways
var01200  Carbon metabolism
Module
var_M00165  Reductive pentose phosphate cycle (Calvin cycle)
var_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
var_M00532  Photorespiration
var_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108322143
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108322143
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     108322143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 108322143
NCBI-ProteinID: XP_017409625
LinkDB All DBs
Position
Un
AA seq 163 aa AA seqDB search
MSAETFSAQVAGAAFVGLKSNSSSLCQSTASITWKRKIASNSSKTYCMKTWNPINNKKFE
TLSYLPPLSDESIAKEVDYMIKKGWIPCLEFDEVXRHMPGYYDGRYWTLWKLPMFGCSDS
SEVLKEIHECREAYPNAYIRCLAFDNKRHMQSMAFIIHKPSTT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaactttttcagctcaggttgctggggctgcctttgttggcttgaagtcc
aactcatcaagtctttgccaaagtacagcatctataacatggaaaaggaagattgcttcc
aactcttctaagacttactgcatgaagacatggaatcccatcaacaacaagaagttcgaa
acactgtcctacctgccacctctttcagatgaatccattgcaaaggaggttgactacatg
atcaaaaagggatggattccttgccttgaatttgatgaggttnacaggcatatgccagga
tactatgatgggaggtattggacattgtggaagcttccaatgtttggttgcagtgattct
agtgaagttctgaaggagatccatgaatgcagagaggcatatccaaatgcgtatatacgt
tgcttagcatttgacaacaagcgtcacatgcagtctatggcttttatcatacacaaacct
tctaccacttga

DBGET integrated database retrieval system