KEGG   Vigna angularis (adzuki bean): 108326457Help
Entry
108326457         CDS       T04660                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00010  Glycolysis / Gluconeogenesis
var00020  Citrate cycle (TCA cycle)
var00620  Pyruvate metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Module
var_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108326457
   00020 Citrate cycle (TCA cycle)
    108326457
   00620 Pyruvate metabolism
    108326457
Enzymes [BR:var01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     108326457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 108326457
NCBI-ProteinID: XP_017415463
LinkDB All DBs
Position
2
AA seq 466 aa AA seqDB search
MASLPNTLSFSSSLSTTLLPCRRFIAFPRRRFSVQAKIREIFMPALSSTMTEGKIVSWIK
SEGDKLSKGESVVVVESDKADMDVETFYDGILAAIVVADGETAPVGAAIGLLVDSPEEVA
EAKAKAAQSASSPATPSAAAPSAAAPEITPPPPPPPPAKSVTDGPRKTVATPQAKKLAKQ
HKVDIATVVGSGPFGRITPADVEVAAGVAPSKSNVSPPVSPAPAAPTPAPKSAAGSAALA
PIPGSSVVPFTTMQSAVAKNMMESLSVPTFRVGYPVTTDALDALYEKVKPKGVTMTAILA
KAAAMALVQHPVVNATCKDGKNFVYNSNINVAVAVAINGGLITPVLQDADKLDLYLLSQK
WKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASRPTVLAD
KDGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIIENPESLTL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcatctctccccaacaccctttccttctcctcctccctctccaccactctcctccca
tgccgccgcttcatcgcattcccccgccgccgtttctccgttcaagccaagatccgcgaa
atcttcatgcccgccctcagctccaccatgaccgaaggcaaaattgtctcctggatcaaa
tccgagggcgacaagctctccaagggtgaaagcgttgtcgtcgttgagtccgacaaggcc
gacatggacgtcgagaccttctacgacggcatcctcgccgccatcgtcgttgccgacggc
gaaaccgctcccgtcggagccgccattggccttctcgttgattctcccgaagaagtcgct
gaagccaaagccaaagccgcccaatctgcttcttctcccgccactccctccgccgccgct
ccctctgccgctgctccggagattactccgccacctcctcctcctcctccggcaaagtcc
gttaccgatgggccaaggaagaccgtggccacgcctcaggctaagaaactcgcgaagcag
cacaaggtggacattgcgacggtcgtgggatccggtccgtttggtcggattactcctgcg
gatgtggaggttgcggccggagtagctccgtcaaagagcaatgtgtctccgccggtgagt
cctgctccggcggcgccaactcctgcaccgaaatctgctgctggttctgctgcactagct
cccattccgggttcgagtgttgttcctttcactacgatgcaatctgcggtggcgaagaac
atgatggagagtctatctgtgcctactttcagggttggttaccctgtgactactgatgca
ttggatgctctttatgagaaggtgaaaccgaagggtgtgactatgacggctattttggct
aaggctgctgcaatggcacttgttcagcaccctgttgtcaatgccacctgcaaagacggt
aagaacttcgtctataacagtaacattaatgttgctgttgccgtggcaattaatggtggt
ttgatcactcctgttctccaggatgcagataagttggacttgtatctgttgtcccaaaaa
tggaaggagctagtggaaaaagctcgtgcaaagcaattgcaacctcatgagtataattca
ggaactttcacactttccaatttgggtatgtttggagttgacaggtttgatgccatactc
ccaccaggccagggtgctatcatggctgttggagcgtctaggcccactgttctggctgat
aaagatggattcttcagcgtgaagaataaaatgctggtgaatgtaactgctgatcatcga
ataatatatggtgctgacttggctgcattcctccagacattctcaaaaatcattgaaaac
ccagaaagcctgacattatag

DBGET integrated database retrieval system