KEGG   Vigna angularis (adzuki bean): 108327100Help
Entry
108327100         CDS       T04660                                 

Definition
(RefSeq) protein cornichon homolog 1
  KO
K20368  protein cornichon
Organism
var  Vigna angularis (adzuki bean)
Brite
KEGG Orthology (KO) [BR:var00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:var04131]
    108327100
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:var02000]
    108327100
Membrane trafficking [BR:var04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    108327100
Transporters [BR:var02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   108327100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 108327100
NCBI-ProteinID: XP_017416309
LinkDB All DBs
Position
3
AA seq 142 aa AA seqDB search
MGLELFFWLIICFPFHIVFLASTFYQVLMLTDLEADFINPYDASSRINYFIVPEFIGQGL
LCAFCLLTGHWIMFLLTVPVTCYHVMLYMKQQHLIDVTEVFRALNSEKKFRLAKLAYYLT
IIIITVFRLVLMLVYYLDSEDE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggagttgttcttttggcttatcatttgtttccctttccacatcgttttttta
gcctcaacgttctaccaggttttgatgctgactgacttagaagccgattttatcaaccca
tatgatgcttcatcaaggattaattacttcatcgttcctgagtttattgggcagggattg
ttgtgcgctttctgccttttaacaggtcactggatcatgtttttgttgacggttcctgtt
acatgctaccatgtgatgctgtacatgaaacagcagcatctcatcgatgttactgaagtg
tttagagcacttaactctgagaagaaatttcgcttggccaaacttgcgtattacttaaca
atcatcattataactgtcttcaggcttgtattgatgcttgtctactatttagattctgaa
gatgaatga

DBGET integrated database retrieval system