KEGG   Vigna angularis (adzuki bean): 108330962Help
Entry
108330962         CDS       T04660                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00020  Citrate cycle (TCA cycle)
var00190  Oxidative phosphorylation
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108330962
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108330962
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     108330962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 108330962
NCBI-ProteinID: XP_017421055
LinkDB All DBs
Position
1
AA seq 620 aa AA seqDB search
MWRCVARANHQSLRSHVSRFFSSGGNSSYNVVDHKYDAVVVGAGGAGLRAAIGLSEHGFN
TACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREA
PKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTGHALLHTLYG
QAMRHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFQAASTILATGGYGRAYFS
ATSAHTCTGDGNAMAARAGVPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGER
FMERYAPTAKDLASRDVVSRSMTMEIREGRGVGSHKDHIYLHLNHLPPEVLKERLPGISE
TAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHHGEVVTIKGNDPDAVVPGLMAAGETACA
SVHGANRLGANSLLDIVVFGRACANRVAEIRRPGDKQKPLEKDAGMKTIAWLDKLRNSNG
SLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHEVKLEDRGLIWNSDLIE
TIELENLLINACITMHSAEARKESRGAHAREDFTKRDDGNWMKHTLGYWENEKVRLDYRP
VHMNTLDNEVESFPPKARVY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtggctcgtgcgaatcaccaatcactgagatctcacgtgtcaagattt
ttctctagtggtggaaactcctcctacaacgtggtcgatcacaagtacgatgcggttgtc
gtgggtgctgggggtgcagggttgagagccgccattggactttccgaacatggcttcaac
actgcttgcatcacgaagctcttcccaactcgttcgcatactgttgcagctcagggaggt
ataaatgctgcattgggaaatatgactgaagatgattggaggtggcacatgtacgacact
gtcaagggaagtgattggcttggggaccaagatgccatccaatatatgtgtagggaggca
ccaaaagcagtcattgaacttgaaaattatggactgccattttcaagaactgaagatgga
aaaatataccagcgtgcatttggtggtcagagcttgaactttggaaaaggtggtcaggca
tatcgttgtgcgtgtgctgctgatcgaactggacatgctttgttgcatactctctacggc
caagctatgagacataatacccagttttttgtggaatattttgcactagatctattaatg
aacagtgatggtagttgccaaggagtgattgccttgaatatggaggatggaacattacat
cgtttccaagcagcttcaacaattttggccacggggggttatggtagagcatatttttcc
gccacctcagcacatacatgtactggagatggcaatgccatggctgcacgggctggggtc
ccacttgaggatttagagtttgtgcaatttcaccctacaggcatatatggagcgggctgc
cttatcacggaaggttctcgtggtgaaggtgggattcttaggaacagtgagggtgagagg
tttatggaacgttatgctcctactgcaaaggatcttgcatcaagagatgtcgtttccaga
tcaatgactatggaaatccgggaaggccgtggtgtaggatcccataaagatcacatctat
ctacacctgaatcacttacccccagaagttctcaaggagagactacctggtatctctgaa
acagctgctatttttgctggtgtggatgttactaaggagcctattcctgttttgccaaca
gtgcattataacatgggtggtattcccacaaatcatcatggagaggtggttactatcaaa
ggtaatgatccagatgcagtagttcctggattaatggctgctggggaaacagcctgtgct
tcagttcatggtgccaataggcttggtgcaaattcacttcttgacattgttgtttttggt
agagcttgtgcaaatagagttgcagaaatccgtagaccaggagataaacaaaagccttta
gagaaagatgctggtatgaaaacaattgcttggctggacaaattgagaaattcaaatgga
tcattgccaacttctaaaattcggttgaatatgcaaagagtaatgcaaaacaatgcggct
gtgttccgtacccaagaaacgttagaagaaggttgtcaattaattgataaaacatgggag
agcttccatgaagtcaagttggaggatcgaggtttgatatggaactctgacttgattgag
accattgagttggaaaatcttttgattaatgcctgcatcaccatgcactctgctgaagca
agaaaagagagtagaggtgctcatgcccgtgaggactttacgaaaagagacgatggaaac
tggatgaaacacactttgggatattgggagaatgagaaggtccggttagattacaggcca
gtgcacatgaacacgttggacaatgaggtggaatcattccctcctaaagctcgtgtttat
taa

DBGET integrated database retrieval system