KEGG   Vigna angularis (adzuki bean): 108334199Help
Entry
108334199         CDS       T04660                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00620  Pyruvate metabolism
var00710  Carbon fixation in photosynthetic organisms
var01100  Metabolic pathways
var01200  Carbon metabolism
Module
var_M00168  CAM (Crassulacean acid metabolism), dark
var_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
var_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
var_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    108334199
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108334199
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     108334199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 108334199
NCBI-ProteinID: XP_017425392
LinkDB All DBs
Position
5
AA seq 967 aa AA seqDB search
MMAARNIEKMASIDAQLRLLAPRKVSDDDKLVEYDALLLDRFLDILQDLHGEDIRQTVQD
CYELSAEYEGEHRPEKLEELGNMLTGLDAGDSIVIAKSFSHMLNLANLAEEVQIAYRRRI
KLLKKGDFADENSAMTESDIEETLKKLVAQLKKTPQEVFDALKNQTVDLVLTAHPTQSVR
RSLLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRA
GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPVIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMAANMYFSQIEDLMFELSMWRCTDELRVRAHELHRSSKRDAKHYIEFWKQ
IPPNEPYRVILGDVRDKLYNTRERARQLLANGTSDIPEETTFTNVEQFLEPLELCYRSLC
ACGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYREWSEE
KRQEWLLSELRGKRPLFGHDLPKTEEITDVLETFHVISELPKDNFGAYIISMATAPSDVL
AVELLQRECHVKEPLRVVPLFEKLADLEAAPASVARLFSIDWYRDRINGKQEVMIGYSDS
GKDAGRLSAAWALYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPAWRALMDEMAVIA
TQEYRSVVFREPRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVVEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDPGIAALF
DKLLVPEELRPFGESLRAKYEETKNFLLQVAGHKDLLEGDPYLKQRLRLRDSYITTLNVL
QAYTLKRIRDPDYHVKLRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgcccgtaacattgagaagatggcctcgattgatgctcagttgaggttgctg
gcaccacgtaaggtctctgatgatgacaaactggttgagtatgatgctcttttgttggac
cgtttccttgacattcttcaggatttgcatggtgaagatatcagacaaacggttcaagat
tgttatgagctgtcagctgaatacgaaggggagcatcgtcctgaaaagttggaggaactt
gggaatatgctgactggtcttgatgctggggattcaattgttattgccaaatcattttct
cacatgctcaatttggccaacttggcagaagaagttcaaattgcttaccgaagaaggatc
aagttattgaagaagggtgattttgcggatgagaactctgccatgacagagtcagacatt
gaagagaccttgaagaagcttgtggctcaactgaagaagaccccccaggaagtctttgat
gctctgaagaaccaaactgtggatttggtcctaactgctcatcctactcagtctgttcgc
agatctttgctgcaaaagcatggaaggataaggaattgtttgacacaattatatgccaaa
gacataacaccagatgataagcaggaacttgatgaggctttacaaagagagattcaagct
gcatttcgcacagatgaaattcgaaggactcctcctacaccacaagatgagatgagggca
ggaatgagctactttcatgagacaatttggaaaggtgtaccaaagtttctgcgccgggtt
gatacagctctgaagaacattggaataaacgaacgtgtcccatataatgcccctgttatt
cagttctcttcttggatgggaggagatcgtgatggtaatccaagagtaacccctgaagtt
acaagggatgtgtgtttgctggctagaatgatggctgctaatatgtacttctctcagata
gaggatctcatgtttgagctgtctatgtggcgttgcactgacgagctccgtgttcgtgct
catgaactccataggtcctcaaagagagatgcaaaacattacattgagttttggaaacag
attcctccaaatgagccatatcgtgttattcttggtgatgtcagagacaagctctataac
acacgtgaacgtgctcgccagttactagccaatgggacctctgatatcccagaggagaca
accttcactaatgttgagcagttcctggagcctcttgaactatgctatagatcactctgt
gcatgtggtgacagaccaatagcagatggaagcctccttgatttcctgcggcaagtttcc
acatttggactctcacttgtgaggcttgacatccgtcaagagtcagataggcacactgat
gtaatggatgcaatcacaaaacacttagaaattggatcataccgagagtggtctgaggaa
aagaggcaggagtggctcttgtctgaactcagaggaaaacgccctctctttggccatgac
cttcccaaaacagaagaaatcactgatgttttggaaaccttccatgtcatttcagagcta
cctaaagacaactttggtgcctacatcatatcaatggccacagccccatctgatgtgctt
gcggtggagcttttgcaacgtgagtgccatgtgaaggagccactgagggtggtgccactt
tttgaaaagcttgctgatcttgaggctgctccggcttccgtggcccgacttttctccata
gattggtacagagaccgcatcaatgggaagcaagaagttatgatagggtactcagactca
ggaaaagatgctggccgtctttcagctgcttgggccctttacaaggctcaagaggaactc
gtgaaggttgctaaggagtttggtgtgaagcttacaatgtttcatgggagaggagggact
gttggaagaggaggaggaccaactcatcttgctattttgtctcagccaccagacaccatt
catggctcacttcgggtaacggttcagggtgaagtcattgaacagtcttttggagaggag
catttgtgctttaggacacttcaaaggttcactgcagccacgcttgagcatggcatgcat
cctcctgtgtcaccaaaacctgcatggcgcgctctcatggatgagatggctgtcattgcc
actcaggagtatcgctctgttgttttcagagagcctcgttttgttgaatatttcagacgt
gcaactcctgagttggagtatggaagaatgaacattggcagtcgtccatcaaagagaaag
ccaagcggaggaattgaatcgctacgtgctattccttggatttttgcatggacacaaaca
aggtttcatttgccagtgtggcttggttttggggcagcatttaagcatgttgttgagaaa
gatccaaagaatctgcaaatgcttcaggatatgtacaaccaatggcctttcttcagggtc
acccttgacttggttgagatggtgtttgccaagggagaccctgggattgcagccctattt
gataaactcctagtgccagaagagctacgtccatttggagagagcttaagggctaaatac
gaagaaaccaagaactttctcctccaggttgctgggcacaaggatcttcttgaaggggac
ccctacttgaagcaaagacttcgacttcgtgactcatacatcacaaccctgaatgtgctg
caagcctacacattgaagagaattcgtgatcctgactaccatgtgaagctgaggccacac
ttgtcaaaggactacatggaatcaagcaagcctgcagcagagcttgttaaacttaacccc
aaaagcgagtatgcacctggccttgaagacacccttattttgaccatgaagggtattgct
gctggcatgcagaacaccggttaa

DBGET integrated database retrieval system