KEGG   Vigna angularis (adzuki bean): 108335268Help
Entry
108335268         CDS       T04660                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00010  Glycolysis / Gluconeogenesis
var00053  Ascorbate and aldarate metabolism
var00071  Fatty acid degradation
var00280  Valine, leucine and isoleucine degradation
var00310  Lysine degradation
var00330  Arginine and proline metabolism
var00340  Histidine metabolism
var00380  Tryptophan metabolism
var00410  beta-Alanine metabolism
var00561  Glycerolipid metabolism
var00620  Pyruvate metabolism
var00903  Limonene and pinene degradation
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108335268
   00053 Ascorbate and aldarate metabolism
    108335268
   00620 Pyruvate metabolism
    108335268
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108335268
   00561 Glycerolipid metabolism
    108335268
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108335268
   00310 Lysine degradation
    108335268
   00330 Arginine and proline metabolism
    108335268
   00340 Histidine metabolism
    108335268
   00380 Tryptophan metabolism
    108335268
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108335268
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    108335268
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108335268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 108335268
NCBI-ProteinID: XP_017426736
LinkDB All DBs
Position
6
AA seq 538 aa AA seqDB search
MASSMRISRLLSRSFLSATTSSLFSRGGSGGLGGGLSKFSTAAATEEPIKPAVRVEHTQL
LIDGKFVNSATGKTFPTLDPRTGDVIAHIAEGDHEDVDRAVAVARKAFDHGPWPKMTAYE
RQKILLRAADLIEKHTDQIAALETWDTGKPYEQVAKIELPIIVRLFRYYAGWADKIHGLT
VPADGPYTVQTLHEPIGVAGQIIPWNFPLLMFTWKICPALACGNTVVIKTAEQTPLSALY
ASKLLHEAGLPPGVLNVISGFGPTAGAAIASHMNVDKLAFTGSTDTGKIVLELAAKSNLK
PVTLELGGKSPFIVCEDADVDEAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAR
ARALKRAVGDPFKVGIEQGPQIDSEQFQKILKYIRSGVESGATLETGGDRFGNSGFYVQP
TVFSNVKDDMLIAKDEIFGPVQSILNFKDIDEVIERANNTQYGLAAGVFTKNIDTANTLS
RALKVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPSWL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcaatgaggatctcaaggctgctctctcgttctttcctttctgctaccact
agttctttgttttctagaggtggaagtggtggtcttggtggaggactcagtaaattcagc
actgctgctgccactgaagaaccaattaaaccagcagttagagtagaacacacccagctc
ttaattgatggaaaatttgttaactctgctaccggaaaaacttttccaacgttggatcct
agaacaggagatgtgattgctcatattgctgagggggaccatgaagatgttgatagagca
gttgccgtggctcgcaaggcattcgaccatggaccttggcctaagatgacagcctatgaa
agacaaaagatattgctacgtgctgctgatctgattgaaaaacacactgaccagattgct
gcacttgagacatgggatactgggaagccatacgaacaagttgctaaaattgaacttcca
attattgttcgcttatttcgatactatgctggttgggcagataagattcatggtcttaca
gttccagctgatgggccatatactgtgcaaacattgcatgaacctattggtgtggccggt
cagatcattccatggaactttcctcttctcatgtttacctggaagatttgcccagcattg
gcctgtggtaacactgttgtgatcaaaacagctgagcagactcctttatctgctctctac
gcatcaaagttgcttcatgaggctggacttcctcctggtgtgttgaacgtcatatctggt
tttggtccaactgctggtgctgccattgccagtcacatgaacgtagacaagcttgctttc
actggttcaaccgatactgggaaaattgtccttgaactggcagctaaaagcaatcttaag
cctgttactctggagcttggtggcaaatccccttttattgtatgtgaagatgctgatgta
gatgaggctgttgagctagcacactttgcattattctttaaccagggacaatgctgctgt
gctgggtcaagaacatttgtacacgaacgtgtgtacgatgaatttgttgagaaagcaagg
gcacgtgctttgaaacgtgctgttggtgatccattcaaagttggaatagagcaaggtcct
cagattgattcagaacaatttcagaaaatattgaagtatattagatctggtgttgaaagt
ggagctacacttgaaactggaggagatagatttggcaactccggcttctatgttcaaccc
actgtcttctcaaatgttaaggatgatatgctgattgcaaaggacgagatctttggccca
gttcaatccatattaaacttcaaggacattgatgaggtgattgaaagagcaaataacaca
cagtatgggcttgcagcaggagtgttcacaaaaaacattgacacggcaaacactttgagc
agagcattgaaagttggaacagtgtgggtgaactgctttgacacatttgatgcagcaatt
ccctttggagggtacaaaatgagtggtcaaggaagagaaaaaggagaatacagtctcaaa
aattacttgcaagtgaaggctgttgtcacacccttgaagaacccatcttggctttga

DBGET integrated database retrieval system