KEGG   Vigna angularis (adzuki bean): 108335789Help
Entry
108335789         CDS       T04660                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108335789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:var03036]
    108335789
Enzymes [BR:var01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108335789
Chromosome and associated proteins [BR:var03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108335789
   Polycomb group proteins
    PRC2-EZH2 complex
     108335789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 108335789
NCBI-ProteinID: XP_017427432
UniProt: A0A0L9UQ56
LinkDB All DBs
Position
6
AA seq 860 aa AA seqDB search
MASSKPSPSPSSSRSELIIDPSGEKVDAVSQTVEDVLPVIDSLKKEVAVERIVYVKNRIE
ENRQKLVGVTNHVCKMAMERRNSSVADSNRSLDLLTKRQKDAIDMHNGVHASNGDVESNG
YHEDTHGSTAVLLGSNVAVKNAVRPIKLPEIKKLPPYTTWIFLDRNQRMTEDQSVVGRRR
IYYDQNGGEALICSDSEEEIMEDEEEKREFIESEDYILRMTVKEFGLTDSVMESLAQCFS
RNTNEIKARYEALSIQDNADGSSKAVDSGENSQSGNSFLEKDLEAALDSFDNLFCRRCLV
FDCRLHGCSQDLVFPAEKQPIWIPPDSENAPCGPNCFRSVLKPERFAKTSSAQADGEDKC
SGGVLSRKKSSAKRRLKGSQSESASSNAKNISESSDSENGPGRDAASASHSAPPKAKPMG
KGIGKRNSKRVAERVLVCMQKRQKKPVVSDSDSISEALERSSNDIVTDLHAMSSEDNTRK
EDSVDDNVCKQEITDNKAWKALEKGLLEKGMEIFGRNSCLIARNLLNGLKTCWDVFQYIN
CEEGKMSGPPGDVANSLLEGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRI
TERKDQPCRQYNPCGCQSACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSR
QCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDV
SGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG
DKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPVWARKPE
ASGSKKEDGAPSSGRAKKLA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgaagccttcgccttcgccctcatcttccagatcggagcttatcatcgat
ccttccggtgagaaagtggacgctgtgagtcagactgttgaagatgtgttaccggttatt
gattctttaaagaaagaagttgctgtggaacggattgtttatgtaaagaatagaatagag
gaaaacagacagaagctggttggtgtcacaaatcatgtctgcaaaatggcaatggagaga
aggaacagcagcgttgctgattctaacagaagtctagacctgcttacaaagaggcaaaaa
gatgcaattgatatgcacaacggtgttcatgcaagtaatggtgatgtagagagcaatggc
taccatgaagatacccatggttctacagcagttcttctagggtctaatgttgctgttaag
aatgctgttcgtcctatcaaattacctgaaataaaaaaattgcctccttatactacatgg
atatttctggatagaaatcaaagaatgaccgaggatcaatcagttgtaggccgaagacga
atttattatgatcaaaatggtggagaagcacttatatgcagtgacagtgaggaagaaatt
atggaggatgaagaggagaaaagagaattcatagaatcagaagattatatacttcgcatg
actgtcaaagaattcggtttaactgacagcgttatggagtcattggctcagtgcttttct
agaaacactaacgaaattaaggcaaggtatgaagctcttagtattcaagacaatgctgat
gggtcttccaaggctgtagattctggagagaactctcagagtggaaattcttttctggaa
aaggatcttgaagcggctcttgactcttttgacaacctcttttgtcgacgatgtctcgtt
tttgattgtagattacatggatgttcacaggatcttgtcttcccagctgagaagcaacct
atatggatccctcctgatagtgaaaatgcaccctgtgggccaaattgtttccgatcggtg
cttaagccagaaagatttgccaaaacatcttctgcccaggctgatggtgaagataagtgc
tctggtggtgttttatctcggaaaaagtcttctgccaaaaggcggttaaaaggaagccaa
agtgaaagtgcttcatctaacgcaaagaacatatctgagagtagtgactcagagaatggt
cctggacgagatgctgcttcagcatctcactcagctcctcctaaagctaaacccatgggg
aaaggaatcggtaagaggaacagtaagcgagtggcagaacgagtcttagtatgcatgcag
aaaaggcagaagaaaccagtagtttctgattccgattccataagtgaagctcttgagcgc
tcatcaaatgatattgtcactgatctacatgctatgagcagtgaagacaacacaaggaaa
gaagattctgtagatgacaatgtttgtaaacaagaaatcacagacaataaagcttggaaa
gctcttgaaaaggggcttttagagaaaggaatggagatttttggtagaaacagttgctta
atagctaggaatctcttaaatggtctaaagacttgttgggatgttttccaatacataaat
tgtgaagaaggaaagatgtctggtccccctggggatgttgcaaattcccttttggagggc
tattccaagggtaataatgaagtgagaagaagatccaggtttttacgcagaagaggaaga
gtccgtcgattgaagtacacatggaaatccgccgcttatcattccatcaggaaaaggatt
acagagagaaaggatcaaccctgccggcagtataatccatgcggttgccaatcagcttgt
ggaaagcagtgtccttgtcttcttaatggaacctgctgtgagaagtactgtgggtgcccc
aagagttgcaagaatcggtttcgtggttgtcattgtgctaagagtcaatgccgaagtcga
caatgtccatgctttgccgctgatagggaatgtgatccagatgtctgtaggaattgttgg
gtcagttgtggcgatggtactcttgggattcctagccaaagaggggacaattacgaatgt
agaaacatgaagcttcttctcaaacagcagcaaagggttcttcttggaaggtcggatgta
tcaggctggggagccttcttaaagaatagtgttggtaaacatgaataccttggagagtat
acaggagagttgatttctcatcgggaagcagataagcgaggaaagatatatgaccgtgaa
aattcatcttttctctttaatttgaatgaccagttcgttctagatgcttaccgaaagggt
gataaattgaagtttgcgaaccattcgcccgatccaaattgctatgcgaaggttataatg
gttgctggagatcatagggtaggcatttttgcaaaggaacggatttgcgccggggaggaa
ctgttctatgattatcgttatgagcctgacagggcccctgtctgggctcggaaacctgag
gcatctggatccaaaaaagaggacggggctccttcaagtggtcgtgcaaagaagcttgct
taa

DBGET integrated database retrieval system