KEGG   Vigna angularis (adzuki bean): 108337213Help
Entry
108337213         CDS       T04660                                 

Definition
(RefSeq) hexokinase-2, chloroplastic
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00010  Glycolysis / Gluconeogenesis
var00051  Fructose and mannose metabolism
var00052  Galactose metabolism
var00500  Starch and sucrose metabolism
var00520  Amino sugar and nucleotide sugar metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Module
var_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
var_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108337213
   00051 Fructose and mannose metabolism
    108337213
   00052 Galactose metabolism
    108337213
   00500 Starch and sucrose metabolism
    108337213
   00520 Amino sugar and nucleotide sugar metabolism
    108337213
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108337213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:var04131]
    108337213
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108337213
Membrane trafficking [BR:var04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108337213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Sir1
Motif
Other DBs
NCBI-GeneID: 108337213
NCBI-ProteinID: XP_017429175
LinkDB All DBs
Position
7
AA seq 495 aa AA seqDB search
MMSVTVTAATCFAAGSYLPRSPRRSFTVALRSDVSSTATRILTELKRECATPLPLLQQVA
KTMSDDMRAGLGLKPGLPMIPTYVENLPTGNEKGLFYALDLGGTNFRVMRVQLGGKDERV
IDTEFDQVSIPQDLMSATSQELFDFIASGLAEFVSKEDGGFHISPGRKREIGFTFSFPVK
QTSIDSGILIKWTKGFAVSGTAGRDVVACLNEAMERQGIDMRVSALVNDAVGTLAGAEYW
DSDVVAAVILGTGTNACYVEKISAIPKLQGHASSSGKMIISTEWGAFSNSLPSTEFDREM
DAATINPGEQIFEKTISGLYLGDIVRRVLLKMTEEGGLFGRFVPQKLSTPFILGTPDLCA
MQQDYSGDLHAVGSLLYDILGAESNLSERKTVLEVCETIVRRGGRLAGAGIVGILQKMEE
DDRGLIFGNGNRSVVAIDGGLYENYPQYRTYLQDSVKELLGSEKSNNVVIEHTKDGSSIG
AALLAASNSIYQQHL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgttacagtcactgccgccacttgcttcgccgcaggctcctaccttccacgg
tcgccacggcggagcttcacggtggctctccgatctgacgtgtcaagtaccgcaacgaga
atattgacggaattgaaacgcgagtgtgccactcctctcccccttcttcagcaagtggcc
aaaaccatgtctgatgatatgcgagctgggcttgggcttaagcccgggcttcccatgata
cccacctatgttgaaaatcttcccactgggaatgagaaagggttgttctatgccttggat
cttggtggaacaaacttccgtgtgatgagggtgcagttgggtgggaaagatgagcgtgtc
atcgacactgagtttgatcaagtttctataccacaggatctcatgtctgctacatcacaa
gagctgtttgatttcattgcttcagggcttgcagaatttgtgtcaaaggaggatggtggg
tttcatatctcaccgggaagaaagagagagattggattcacgttttcatttcctgtgaag
cagacatctattgattctggcatactaatcaagtggacaaagggttttgcagtctctgga
acagcaggaagagatgtggttgcttgtctgaatgaggcaatggaaagacaaggaatagat
atgcgagtttctgctctggtgaatgatgctgtgggaacgttagctggagcggaatactgg
gacagtgatgttgtggctgctgtcattttgggtaccggaaccaatgcttgctatgttgag
aagatcagtgccattcctaagttacagggccatgcctcttcttctggcaaaatgatcatt
agcactgagtggggagctttctcaaatagtctcccttcaaccgagtttgacagggaaatg
gatgctgctaccatcaatccaggggagcagatctttgaaaagacaatctcaggactgtat
ctaggcgacattgttagacgagtgttactgaaaatgactgaagagggtggtttgtttggc
agatttgtcccacaaaaactatctacaccattcatactcggaaccccagatctatgtgcc
atgcagcaagactattctggcgacttacatgcagttgggtccctcctctatgatatatta
ggggctgaatccaatttaagtgaaagaaaaacagttttagaggtttgtgagactattgta
aggagaggagggaggttagctggtgcaggaattgtggggattctacagaaaatggaagag
gatgacagaggtctcatatttggcaatggaaacagaagtgttgttgccattgatgggggc
ttatacgaaaattatcctcaatacaggacttatttgcaagattcagtgaaagagctgcta
gggtcagaaaaatcaaacaatgtggtgatagaacatacaaaagatggatcttccatagga
gctgctctgttggctgcttcaaattccatctaccaacaacacttatag

DBGET integrated database retrieval system