KEGG   Vigna angularis (adzuki bean): 108340736Help
Entry
108340736         CDS       T04660                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:var00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108340736
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108340736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 108340736
NCBI-ProteinID: XP_017433773
UniProt: A0A0L9V6L8
LinkDB All DBs
Position
8
AA seq 204 aa AA seqDB search
MHLAMAANAVVAPSPFQPSSLLRSSFSGVSVKLTPQSLTFSRSRTLTVFAATKKAVAVLK
GTSAVEGVATLTQEDDGPTTVTVRITGLTPGLHGFHLHEYGDTTNGCISTGAHFNPKKLT
HGAPEDEIRHAGDLGNIVANADGVAEASIVDNQIPLAGPNSVVGRALVVHELEDDLGKGG
HELSLTTGNAGGRLACGVVGLTPA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcatctagcaatggcagccaacgctgtcgtcgctccgtcgccgttccaacccagctcg
cttctccggtcatctttctccggcgtctccgttaagctcactccccaatccctaaccttt
tcgcgctcgaggaccctcaccgtcttcgccgccaccaagaaggccgtcgccgtcctcaag
ggaacctccgccgtcgaaggcgtagccaccctaacacaagaagacgatggcccaacaacg
gttactgttcgcattactggccttactccggggcttcatggttttcaccttcatgagtat
ggtgataccacaaatgggtgtatttcgacaggagcacattttaatcctaaaaaattgaca
catggtgctcctgaggatgaaatccgtcatgcgggtgacctgggaaacatagttgctaat
gcagatggggttgcagaggcttcaatcgtggataatcagataccactcgctggccccaat
tcagtagttggaagagccttggtggttcatgagcttgaggatgatcttggaaaggggggt
catgaacttagtttgacaactggaaatgctggtggaagattagcatgtggtgtggttggt
ttgactccagcataa

DBGET integrated database retrieval system