KEGG   Vigna angularis (adzuki bean): 108340897Help
Entry
108340897         CDS       T04660                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00052  Galactose metabolism
var00500  Starch and sucrose metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108340897
   00500 Starch and sucrose metabolism
    108340897
Enzymes [BR:var01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     108340897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 VirE1
Motif
Other DBs
NCBI-GeneID: 108340897
NCBI-ProteinID: XP_017433951
UniProt: A0A0L9VDY3
LinkDB All DBs
Position
9
AA seq 895 aa AA seqDB search
MAAPTFLLLFSLFIFLSLIFCSASSPLGYGYTISSLHAYPKNNSFIAHLNLIKPSSLFGP
DIPHLSLHASFENKDRFRLRITDSNNKRWEIPQHLIPRVSPSQYQPLRHLHGSPQALSLT
HPDSDLVFTLHNTTPFGFTLSRKSSNDVLFNAAPDPSNPQTFLVFKDQYLQLSSSLPPQR
ASLYGLGEHTKSSFKLQPNQTLTLWNAGIASANPDVNLYGSHPFYLDVRSPSPDGRVTAG
TSHGVLLLNSNGMDIVYGGDRITYKAIGGVFDLYFFAGSSPELVLEQYTELIGRPAPMPY
WSFGFHQCRWGYKNVSDIQSVVANYAKAAIPLEVMWTDIDYMDAFKDFTLDPINFPLDKM
RSFVDTLHQNGQKYVLILDPGINVNETYATYVRGLNADVYIKRNGTNYLGEVWPGPVYYP
DFLNPQSQLFWGGEIKLFRDLLPFDGLWLDMNELSNFITSPPIPSSNLDNPPYKINNGGV
VRSINYRTVPATSLHYGNITEYNAHNLYGLLESKVTNEELVNITGKRPFILSRSTFVSSG
KYAAHWTGDNAATWNDLAYSIPSILNSGIFGIPMVGADICGFGGNTTEELCQRWIQLGAF
YPFSRDHSEINSIRQELYIWESVAASARKVLGLRYRLLPYFYTLMYEAHTKGIPIARPLF
FSFPEDVTTYDISSQFLLGKGVLVSPVLQSGATTVDAYFPKGTWFDLFDVSNSVIAESGK
YVTLDAPSDHINVHVGEGNVLALQGEALTTDAARKTAFELMVVMSGSGNSYGEVYLDDGE
ALDVAGVKYEWTLVRFYGAIQNTSVVITSKVTNGRFALDQRWIIDKVTFLGIPKHQKFNR
MDLSEKELNIVNRTGSMTNAVMKSHFDSSSEFVTVQVSKLSLLIGKEFKLEVEIK
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacccactttccttctactcttctctctctttatctttctttctcttatcttc
tgctcagcttcatcaccacttggatatggctacaccatctcgtctcttcatgcttatcca
aaaaacaactctttcattgcacaccttaaccttatcaaaccttcctctctgttcggaccc
gacattcctcacctctcccttcatgccagctttgagaacaaggataggttcagactcaga
atcactgactccaacaacaaaagatgggaaattccgcagcatctcattcccagagtctcc
ccttctcagtatcaacctcttcgccacctccatggttccccacaggctctcagtctcaca
catccagactcagaccttgttttcaccctccacaacaccaccccatttggtttcactctg
tcgcgcaaatcctccaacgatgttctctttaatgccgcaccagacccttccaaccctcag
acttttcttgtcttcaaagaccagtacttgcagctctcctcctcgctcccgccacaaaga
gcctctctttacggcctcggggaacacaccaagagctccttcaagctccaacccaaccag
acccttacactgtggaatgcaggtattgcaagcgccaacccggacgtgaacctttatggc
tctcaccctttttacttggacgtgagatcaccctctccagatggaagagtgacggctggc
acctcacatggggtgttgctgcttaacagcaatggaatggatattgtgtatggcggtgat
cgcattacttataaggccattggtggggtttttgatctttactttttcgctggatcctct
cccgagctggtgttggagcaatacactgaactcataggcagacctgctccaatgccttat
tggtcctttggttttcatcagtgtcgatggggatacaagaatgtaagcgatatacagagt
gtggttgccaactatgcaaaagcagctataccccttgaagttatgtggacggatattgat
tacatggatgcatttaaagatttcaccttagatcccatcaactttccgctggataagatg
agaagctttgttgacactcttcatcaaaatggtcagaaatacgttcttatcttggatcca
ggtatcaatgtaaacgagacatatgcaacctatgtcagaggcttgaacgctgatgtctat
ataaagagaaatggaaccaattatcttggtgaagtttggcctggaccagtttattaccca
gattttcttaaccctcaaagccaattattttggggtggggaaatcaaattatttagggac
cttctcccttttgatggtctttggcttgacatgaatgaattatctaatttcattacttct
cctcccattccatcttctaatcttgataaccctccttacaaaattaacaatggtggagtt
gtacgatccattaattacagaacagtccctgccacatctttacactacggtaacatcact
gagtataatgcccacaatttgtatggactactagaatccaaagtaactaacgaggaactg
gtgaatataactggtaaaaggccattcattctgagtagatcaacttttgtaagttctggt
aagtatgctgcacattggacaggagataatgctgctacatggaatgatttggcctactca
attccatcgatattaaattctggaatctttgggattccaatggttggagcagatatatgt
ggtttcggaggaaatacaactgaagaactttgccagcgctggatccagttgggggctttt
taccccttttccagagatcattcagaaataaactccatcagacaagagctttacatttgg
gaatcagttgcagcatcagctaggaaagtgcttggacttcgttaccgtcttctcccttat
ttctacacactaatgtacgaagcacatacaaaagggatacccattgcacggccacttttc
ttttcattccctgaggatgtcacaacatatgacataagctctcagtttctattaggcaaa
ggggttctggtatcacccgtactacaatctggggcaaccactgttgatgcatactttcct
aaaggaacctggtttgacctctttgatgtctcaaattcagtgattgcagaatcaggcaag
tatgtgactctcgatgctccatctgatcacataaatgtgcatgttggggaaggtaatgtt
ttggccttgcaaggagaagcattgacaactgatgctgcccggaaaactgcatttgaactt
atggtagttatgagtggcagtggaaatagttatggtgaagtgtatttggatgatggggaa
gcattagacgtagcaggggtgaaatatgagtggacattggtaaggttttatggggctata
cagaacactagcgttgttattacatctaaggtgactaatggaagatttgctctggaccaa
aggtggatcatagacaaggtaactttcttggggatacccaagcatcagaaattcaataga
atggatttgtcagagaaagagttgaatattgtgaatagaacaggttcaatgactaatgca
gttatgaagtcacattttgatagctcatctgagtttgttactgtacaagtttctaaattg
tcacttcttattggaaaagaattcaagctggaggtagaaatcaagtag

DBGET integrated database retrieval system