KEGG   Vigna angularis (adzuki bean): 108342725Help
Entry
108342725         CDS       T04660                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:var00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108342725
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     108342725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 108342725
NCBI-ProteinID: XP_017436006
UniProt: A0A0L9VCX3
LinkDB All DBs
Position
9
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTVYFSQDGNGPTTVTGTLAGLKPGHHGFHVHALGDTTNGCLSTG
PHFNPNSKEHGAPEDENRHAGDLGNVNVGDDGTATFSITDSQIPLTGPNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttggcagcagtgagggtgtcactggaactgtctacttc
agtcaggacggaaatggtccaaccactgtaactggcactcttgctggtcttaagcctggt
caccatggtttccatgtccatgccttgggggacactaccaatggttgcctgtcaactgga
ccacactttaatcctaatagcaaggagcatggtgcccccgaggatgagaatcgccatgct
ggtgatctagggaatgtaaatgttggtgatgatggtaccgccaccttcagtataactgac
agtcagattcctctcactggaccaaactccatcattgggagagctgttgttgtccatgct
gatcctgatgatcttgggaaaggtggtcatgagcttagcaagtctactggaaatgctggt
ggcagagtagcatgtggtatcattggtttgcaaggataa

DBGET integrated database retrieval system