KEGG   Vigna angularis (adzuki bean): 108343524Help
Entry
108343524         CDS       T04660                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00250  Alanine, aspartate and glutamate metabolism
var00410  beta-Alanine metabolism
var00430  Taurine and hypotaurine metabolism
var00650  Butanoate metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108343524
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108343524
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108343524
   00430 Taurine and hypotaurine metabolism
    108343524
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108343524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 108343524
NCBI-ProteinID: XP_017437350
LinkDB All DBs
Position
9
AA seq 501 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFRMPEESIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEESETAVG
VGTVGSSEAIMLAGLAFKRRWQNRRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPDQAAELVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKQTGWETP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRDNMLVLKEGLEK
TGRFAIVSKDNGVPLVAFTLKDHTHFDEFQISDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSRTLAERLVADVEKVVHELDSLPARVISSTTVAVNTEENGKVVKKSALETQREIT
AVWKKFVLERKKLNDKMNGVC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccaaaaccgcttccgaatccgacgtttctgtccactccaccttcgcttct
cgctatgtcagaacttcacttcccaggttcaggatgccggaggagtcgattccaaaggaa
gcagcgtaccagatcataaacgatgagttgatgttggatgggaacccaaggttgaacttg
gcttcgtttgtgacgacatggatggaacctgagtgtgataaactcatcatggcttccatc
aataagaactatgttgacatggatgagtaccctgtcaccactgagcttcagaaccgatgt
gtgaacatgatagctcatctttttaatgcaccactagaagaatctgaaactgctgttggt
gttggcacggtcggttcatcagaggccataatgttggctggattggccttcaaaaggagg
tggcaaaacagaaggaaagcagagggaaagccttatgacaaacccaacattgtcaccgga
gccaacgttcaggtttgctgggagaaattcgcaaggtacttcgaggtggagttgaaggaa
gtgaagctgcgtgatggatactatgtaatggaccctgaccaggctgcggaattggtggat
gagaacactatttgtgttgctgctatccttggttccacactaaacggagagtttgaggat
gtcaaacgcctcaatgatcttcttgttgaaaagaataagcaaactgggtgggaaactcct
attcacgttgatgcagccagtggtggattcattgctccatttatttacccagagcttgag
tgggatttccgattaccactagtgaagagcatcaatgttagtggacacaaatatggtttg
gtgtatgctggaatcggttgggttatctggaggagcaaggaggacctgcctgaagaactc
atcttccatatcaactatctcggagctgatcaacccaccttcacacttaacttctccaaa
ggttccagccaagtcattgctcaatactaccaactaattcgccttggttttgagggctac
agaaacgtgatggaaaattgcagagacaacatgttggtgctgaaagagggactcgagaag
acagggcggtttgccattgtgtccaaagacaatggtgtgcctttggttgctttcaccctg
aaagaccacactcactttgacgagtttcaaatctctgacctgctgagacgttttggatgg
attgtgccagcatacaccatgcccccagatgctcaacatgttacagtgcttcgtgttgtc
atcagggaggacttttcaagaactcttgcagagcgtctggtggcagatgtggaaaaggtg
gtgcatgagcttgatagccttccagcaagggtgatcagtagcaccaccgtggcagtcaac
acagaagaaaatggcaaagtggttaagaagagtgctctggagacacagagggaaatcact
gcggtttggaagaagtttgtgttggagaggaagaagctcaatgacaagatgaatggtgtt
tgctag

DBGET integrated database retrieval system