KEGG   Vigna angularis (adzuki bean): 108343752Help
Entry
108343752         CDS       T04660                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00250  Alanine, aspartate and glutamate metabolism
var00410  beta-Alanine metabolism
var00430  Taurine and hypotaurine metabolism
var00650  Butanoate metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Module
var_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108343752
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108343752
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108343752
   00430 Taurine and hypotaurine metabolism
    108343752
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108343752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 108343752
NCBI-ProteinID: XP_017437607
UniProt: A0A0L9VHU8
LinkDB All DBs
Position
10
AA seq 499 aa AA seqDB search
MVITSTATHPDEQAQSIFSTFASRYVREPIPRFKIPENSIPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNIIANLFHAPINEDET
AVGVGTVGSSEAIMLAGLAFKRKWQTKRKAEGKPYDKPNIVTGANVQVCWEKFGRYFEVE
LKEVKLTEGYYVMDPVKAVEMVDENTICVAAILGSTMTGEFEDVKLLNELLTEKNKKTGW
DTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWKSKDDLP
DELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCLENTRVLKEG
IERTGQFNIISKDIGVPLLAFSLKDSSQHSVFEISDQLRKFGWIVPAYTMPPDAQHIAVL
RVVVREDFSRGLAQRLVSDIEKVMKLLDSLPSTVSNKTAHITAITNEASEKIKKSATETQ
REIVLYWKRLVGGKKHGAC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacatccactgctacacacccagatgaacaagcacagagcatattttctacc
tttgcttccagatatgtgcgtgaacctattcccaggttcaagataccagagaattcaata
ccaaaggatgctgcttatcagattataaacgatgagttgatgctggatggcacaccaaga
ctcaacttggcctcatttgtgaccacttggatggagcctgagtgtgacaagctcataatg
gcttcacttaacaagaactatgttgacatggatgagtaccctgtcaccactgagctccag
aatcggtgcgttaatataatagcaaatctattccacgctcctataaatgaagatgagaca
gcagtaggtgtgggaactgtggggtcatcagaggcgataatgttagcaggtttggctttt
aaaaggaaatggcagaccaagagaaaagcagaaggcaaaccatatgacaagcctaacata
gttactggggctaatgtgcaggtttgttgggaaaaatttggaaggtactttgaggtagag
ctcaaggaagtgaaactcactgagggatactatgtgatggacccagtgaaagcagttgaa
atggtggatgagaacaccatctgtgttgcagccattttgggatcaactatgacaggagag
tttgaggatgtgaaacttctcaatgaacttctcactgaaaagaacaagaagacaggttgg
gataccccaattcatgtagatgctgccagtggggggtttattgctccatttctgtatcct
gatctagagtgggattttcgtttgccattggtgaaaagcatcaatgttagtggtcacaag
tatggtcttgtgtaccctggtgttggttgggttgtctggaagagtaaggatgacttgcca
gatgaacttgtttttcacatcaattaccttggttctgatcagcccactttcacattgaat
ttctctaaaggatccagtcaaattattgcacaatattaccagtttattcgtcttggcttt
gagggttataaaaacatcatggaaaattgcttggagaatacaagagttctgaaagaggga
attgagagaacagggcagtttaacatcatctccaaggatataggggtgccccttttggcc
ttctctttgaaagacagtagccaacactcagtgtttgagatatcagaccagctgagaaaa
tttggctggatagttccagcctacacaatgccaccagatgcacaacacattgcagtccta
agggtggtggtcagggaggatttcagccgtggcttggctcagagacttgtttctgacata
gaaaaagttatgaagctcttggactcacttccaagcactgtctctaacaaaactgctcat
atcacagccatcactaatgaggctagtgagaagataaagaagagtgcaacagaaactcag
agagagattgttttgtactggaagcgacttgtgggtggcaagaaacatggagcatgctag

DBGET integrated database retrieval system