KEGG   Vigna angularis (adzuki bean): 108346086Help
Entry
108346086         CDS       T04660                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108346086
Enzymes [BR:var01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108346086
Chromosome and associated proteins [BR:var03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108346086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 108346086
NCBI-ProteinID: XP_017440530
LinkDB All DBs
Position
10
AA seq 363 aa AA seqDB search
MPLKESRISSTLSDFMPAMKKNSEQTHFGSVFNKLLKELREPVDFELPNWFNKSKPMQYS
YIKRNIYLTKKVKRSRFDDDGIFCSCTPSAGSTSVCGRDCHCGMLLSSCSSGCKCGSSCL
NKPFQNRPVKKMKLVQTEKCGSGIVADEDIEHGEFVIEYVGEVIDDRTCEERLWNMKHRG
ETNFYLCEINRDMVIDATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIQKGE
HLTYDYQFVQFGADQDCHCGAATCRRKLGVRPTKPKMSSDAALKLVAYQVYQNGRLQIGG
SRVNHRKCLHNCIGEVIRIKSFEKERFGVIKRFDEHSRKHSIMFEDGCVEIYDMSKEDWE
LVR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaaggaatcaagaatatcaagtactctatcagatttcatgcctgccatgaaa
aagaattctgagcagactcattttggatctgttttcaacaagttgttgaaggagcttcga
gaacctgttgactttgaacttcctaattggtttaataaatcaaagccaatgcagtactcc
tatataaaacgcaatatatatctcacaaagaaggtcaaaagatcccggtttgatgatgat
ggcatattctgttcctgtactccttccgctggatctactagtgtatgtggtagagattgc
cactgtgggatgcttctgtctagctgttcatcaggctgtaaatgtgggagctcttgtctt
aacaaaccattccagaatcgccctgtgaaaaagatgaaattggttcagactgagaaatgt
ggttctggaattgtggcggatgaagatatcgaacatggggagtttgttatagaatatgtt
ggagaagtcattgatgatagaacatgtgaggaaaggctttggaacatgaaacaccgtggt
gaaacaaatttctacttatgtgaaatcaatcgagatatggtgatagatgcaacatataag
ggaaacaaatcaagatacatcaaccatagttgctgtccaaatactgagatgcagaaatgg
ataattgatggtgaaacaagaattggcatatttgcaactcgtgacatacaaaagggcgag
catctgacttatgattaccagtttgttcaatttggtgcagatcaagattgccactgtggt
gctgctacatgtaggcgtaaattgggtgttcgacctaccaagcctaaaatgtcttcagat
gctgcattaaaattagttgcataccaggtttatcagaatggacgcttgcaaattggaggt
tctcgtgttaaccaccgaaaatgcttacacaattgcattggtgaagttattagaataaaa
agctttgaaaaggagaggtttggagtcattaaacggtttgatgaacattctcgaaaacat
tcaatcatgtttgaggatggttgtgttgaaatttatgacatgtcaaaagaggactgggag
cttgtgagatag

DBGET integrated database retrieval system