KEGG   Vigna angularis (adzuki bean): 108346640Help
Entry
108346640         CDS       T04660                                 

Definition
(RefSeq) transcription factor bHLH140
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
var  Vigna angularis (adzuki bean)
Brite
KEGG Orthology (KO) [BR:var00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:var03400]
    108346640
Enzymes [BR:var01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     108346640
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     108346640
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     108346640
DNA repair and recombination proteins [BR:var03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108346640
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     108346640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C HIT Macro AAA_33 zf-C2HE Zeta_toxin AAA_16 AAA_18 Ploopntkinase3
Motif
Other DBs
NCBI-GeneID: 108346640
NCBI-ProteinID: XP_017441188
LinkDB All DBs
Position
11
AA seq 760 aa AA seqDB search
MDMMDVDETSAPREGKPVLVILVGAPGSGKSTFGEDVMRSSTRHWVRVCQLQLRFKAMKT
GLGVLVRRGKLMGNVIDRCNLDREQRSEFIKLGGGLQIDVHAVVLDLPAKLCISRSVNRT
GHEGNLQGGRAAAVVNRMLQHKELPKLSEGFNRITFCQNENDVKNAINLYSSLGPLDNLP
HGCFGQKNTDSKIQVGIMKFLKRAEVPLAAASTTSGTEEPTSQTPRNNSYCKDKEALSSI
SDTDNLETKEVERQEVGSAGSHANPVCPDDIPTLAFPSISTSDFQFNLEKAADIIVEKVA
EFLNKFRNARLVLVDLSHKSKILSLVKARIAEKNMDTQKFFTHVGDITHLYSRGGLRCNA
IANAANWRLKPGGGGVNAAIFNAAGPELESATKDKVKSLSPGNAAVVPLPSSSPLFTREG
VTHVIHVLGPNMNPQRPNYLNNDYNKGCKILQDAYTSLFDGFASIVRNHPGIPEGKGEKL
ERKSLELPVQSDCSSRKYFTGTDQKSKRSDDHGSEKSKKCKGTQDDLGLPFTDSKGEKVD
SEHRRIERSRSKAWGSWAQALHQIAMHPEKHKGDLLEISDDVVVLNDIYPKAQKHVLVLA
RTGGLDCLADVQKEHLQLLNMMHDVGLKWAEKFLSENASLVFRLGYHSAPSMRQLHLHVI
SQDFESTQLKNKKHWNSFNTAFFRDSVDVMDEVSSDGKATLKDDDKLLSMELRCHRCRSA
HPNIPRLKSHIRSCQSPFPAYLLQNGRLVHAPGEPRNSVQ
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatggacgtggatgaaacttctgcacccagagagggcaagcccgttttggtg
atcctggtaggagcacccgggagtggtaaatccaccttcggcgaagatgtaatgcgttca
tctactcgccactgggttcgcgtttgccagttgcaactacgcttcaaagccatgaaaaca
ggcttgggggtgttggttcgtcgtgggaaattaatgggaaatgttattgacaggtgcaat
cttgacagagaacagcggtcagaattcataaagcttggtggtggactccaaatagatgtc
catgcagttgtacttgatcttcctgcgaagctttgtatttctcgatcagtcaatcgaact
gggcatgaaggaaatttgcagggtggaagagcagctgcagttgtgaatagaatgcttcaa
cataaagagcttcccaaattaagtgaaggctttaaccggataacattttgtcagaatgag
aatgatgtaaaaaatgcgattaatttatacagctcacttgggccactggataatcttccg
catggctgctttggccagaagaatacagattcgaaaattcaagttggcataatgaagttc
ctaaaaagagcagaggtcccacttgctgctgcatctacaacgagtggcactgaagagcct
acttcccagactccgagaaataattcgtactgcaaagataaggaagcactttcctcaatt
tcagatactgacaacttagagacaaaggaagtagaaaggcaagaagttggttctgctggt
tcgcatgccaatccagtttgtccggatgatattccaactctggcatttccctctatttca
acatctgatttccaattcaatcttgagaaggcagctgatattatcgttgagaaggttgca
gagttcttaaataagtttaggaatgccagacttgttcttgttgacttatctcataagtca
aagattttgtccttagttaaagccagaattgcagaaaaaaacatggacacccaaaagttt
tttacccatgttggggacattactcatctttattccaggggaggtttgcgatgcaatgcc
attgctaatgctgccaactggaggttgaaacctggaggtggaggtgttaatgcagcaatt
tttaatgctgcaggtccagaactggagtctgcaacaaaagataaagtaaaatctctttca
cctgggaatgctgctgttgtccctctgccttcatcttctcctttgttcaccagagagggt
gtaacccatgtaatacatgttcttggacctaatatgaacccacaaagaccaaattatcta
aataatgattataataaaggctgcaaaattctgcaagatgcttatacttcactctttgat
ggttttgcgtctattgtgcggaaccacccagggataccagagggaaaaggtgaaaagctt
gaaaggaaatcattggagttgccggttcagtctgattgttcttccagaaaatattttaca
ggtactgatcaaaagagtaagagaagtgatgatcatggatcagagaaaagcaagaaatgc
aagggaactcaggatgacttaggattgccctttactgattctaagggtgaaaaggtagat
tcagagcatagaagaatagagaggagcaggagtaaggcttggggatcatgggctcaagct
cttcaccaaatagctatgcatcctgaaaagcataagggtgatttgcttgaaatttccgat
gatgttgttgtattgaatgatatctatccaaaggcgcagaagcatgttctggtgttggca
cgaactgggggtcttgactgcctcgctgatgtccaaaaggagcaccttcagttattgaac
atgatgcacgatgtgggtttaaagtgggctgagaagttcttaagcgagaatgcttctctg
gtatttcgacttgggtatcactcggcaccatcgatgcgacaactacatttacatgttatt
agccaggactttgaatcaacacaattaaagaataagaagcactggaactcatttaacact
gctttctttcgtgactcggttgatgtaatggatgaggtctctagtgatgggaaggcaacg
ttgaaagatgatgacaagctactctctatggagttgaggtgccacagatgtagaagtgca
catccaaacataccccggttaaaatctcatataagaagctgccaatccccatttcctgca
tacctacttcagaatggacgtttagtgcatgctccgggggaacctcgcaacagtgtacag
tag

DBGET integrated database retrieval system