KEGG   Vigna angularis (adzuki bean): 108347322
Entry
108347322         CDS       T04660                                 

Definition
(RefSeq) cytochrome P450 704B1
  KO
K20495  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00071  Fatty acid degradation
var00073  Cutin, suberine and wax biosynthesis
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108347322
   00073 Cutin, suberine and wax biosynthesis
    108347322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:var00199]
    108347322
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     108347322
Cytochrome P450 [BR:var00199]
 Cytochrome P450, plant type
  CYP704 family
   108347322
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 108347322
NCBI-ProteinID: XP_017441977
LinkDB
Position
11
AA seq 515 aa
MGGLVVLICMVVSWMFIHRWSQRNKKGPKTWPFFGAAIEQLMNYDRMHDWLVNYLSKSKT
VVVPMPFTTYTYIADPNNVEHVLKTNFNNYPKGRVYHSYMKVLLGDGIFNVDGETWKKQR
KTASLEFASRNLREFSTKVFREYALKLSAILIQASILNQEIDMQELLMRMTLDSICKVGF
GVEIGTLSSNLPKNSFADAFDTANIIVTLRFIDPLWKIKKMLSIGSEAKLEKSIKVVDDF
TYSVIRKRKAEIEDVRKSGQQNQMKHDILSRFIELGESNATDKSLRDIVLNFVIAGRDTT
ATTLSWAIYMVMTHAHVADKLYLELKLFEENHAKEENISLPQFDKEDSESFNQRVEQFSR
LLNKDSLERLHYLHAVITETLRLYPAVPQDPKGILEDDVLPDGTKVKAGGMVTYVPYSMG
RMEYNWGSDAASFVPERWFKDGVLKNESPFKFTAFQAGPRICLGKDSAYLQMRMVLAILC
RFYKFKLVPGHTVQYRMMTILSMAHGLKVTIHKRC
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgggagggttagtagtactgatatgcatggttgtttcatggatgttcatacatagatgg
agtcaaagaaacaagaaaggtccaaaaacttggcccttttttggagctgctattgaacaa
ttgatgaactatgacagaatgcatgattggctagtcaattatttgtccaaatcaaaaact
gttgtggttcctatgcctttcacaacttatacttacattgctgaccctaataatgtagaa
catgtactcaagaccaacttcaataattatcctaagggtagagtgtaccattcatatatg
aaagtgcttcttggagatggaatatttaatgttgatggtgagacttggaagaagcaaagg
aaaactgcaagcttagagtttgcatccagaaatttaagggaatttagcacaaaagttttc
agggaatatgccttgaaactttctgctattctcattcaagcatctattcttaaccaagaa
atagacatgcaggaactgttgatgagaatgactttggactccatatgtaaggttggattt
ggagtggaaattggaacactgtcttccaatttaccaaagaacagttttgctgatgcattt
gacactgcaaatatcatagtaacacttcgtttcattgatccactttggaagattaagaaa
atgctaagtataggctctgaagcaaaacttgagaagagtatcaaagttgttgatgatttc
acctactcagtaattcggaaaaggaaggcagagatagaagatgtcagaaaaagcgggcaa
caaaatcagatgaagcatgatatattgtcaagattcatagaactaggagaaagcaatgca
acggacaagagtttgagagatattgtgttgaactttgtcattgctggtcgagacacaact
gcaacaaccctgtcatgggccatatacatggtaatgacacatgctcatgttgctgacaaa
ctttaccttgagctgaaactttttgaggagaatcatgcaaaagaagagaacatttccttg
cctcaatttgacaaagaggactcagaatcattcaatcaaagagtagaacaattttcaagg
cttttgaataaagattcactagagagattgcactatctgcatgctgtgataacagagacc
ttaagattgtatccagcagttcctcaggatcctaagggcatattagaggatgatgtattg
ccagatggaaccaaagtaaaggcagggggaatggtaacatatgttccatactctatggga
aggatggagtataattggggttctgatgcagcttcgtttgtccctgagagatggttcaaa
gatggtgttctaaaaaatgagtctccattcaaattcactgcttttcaggcaggtcctagg
atatgccttggcaaggactctgcatatctgcagatgaggatggtgctagctattttgtgc
agattttacaagttcaagttggtgccaggtcatacagtgcaatataggatgatgacaata
ttatcaatggctcatggtttgaaagttaccatacacaaacgatgttag

DBGET integrated database retrieval system