KEGG   Vigna angularis (adzuki bean): 108347646Help
Entry
108347646         CDS       T04660                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00220  Arginine biosynthesis
var00250  Alanine, aspartate and glutamate metabolism
var00710  Carbon fixation in photosynthetic organisms
var01100  Metabolic pathways
var01200  Carbon metabolism
var01210  2-Oxocarboxylic acid metabolism
var01230  Biosynthesis of amino acids
Module
var_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108347646
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108347646
   00220 Arginine biosynthesis
    108347646
Enzymes [BR:var01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     108347646
Amino acid related enzymes [BR:var01007]
 Aminotransferase (transaminase)
  Class I
   108347646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 108347646
NCBI-ProteinID: XP_017442520
LinkDB All DBs
Position
11
AA seq 542 aa AA seqDB search
MRRIVADRFRRLFNRSFLLHRHHHNHNHPPFPASSSLTSHYPFSPYRFFFSTPFSSMASD
SPFPVTAQNINPKVLKCEYAVRGEVVTLAQNLQKDLLANPGSHPFDEILYCNIGNPQSLG
QSPITFFREVLALTDHPAILDKSETQGLFSADAIERAWQIVEQIPGRATGAYSHSQGVKG
LRDTIAAGIEERDGFPANPDDIFMTDGASPAVHNMMQLLIRSENDGILCPIPQYPLYSAS
IALHGGFLVPYYLDEASGWGLEIPELKKQLDAAKSKGINVRALVVINPGNPTGQVLSEEN
QRHIVDFCKQEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGENDVTLVSFQSVSKG
YHGECGKRGGYMEVTGFSAEVREQIYKMASVNLCSNISGQILASLVMSPPKVGDESYESF
MAEKGNILASLARRAKTLEDAFNKLEGVTCNKAEGAMYLFPQIRLSQKAIKAAEEAKTAP
DNFYCKRLLNATGVVVVPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRLTEFHEKFMDEF
RD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcggagaatcgttgcagacagattcaggcgccttttcaaccgttcattccttcttcat
cgtcatcatcacaatcacaatcaccctccctttcctgcttcttcctctctcacttctcac
tatccgttttccccctatcgcttcttcttttctactcctttttcttccatggcttctgat
tcacctttccctgtcactgctcaaaacatcaacccaaaggttctgaaatgtgagtacgcc
gttagaggagaggttgtcacacttgctcagaatttgcaaaaggatttactggccaatccc
ggttctcatccatttgacgagatactttactgcaacattggaaatcctcagtctcttggc
cagtctccaataacctttttccgagaggttcttgctttaactgatcatccagctatattg
gacaaaagtgaaacacagggtttgttcagcgctgatgcaatagaacgagcttggcagatt
gtggaacagattcccggtagagcaactggtgcctatagccacagtcagggtgtcaagggt
ttgcgtgatacaatagctgctggaattgaagagcgtgatggttttcctgctaatcctgat
gacattttcatgacagatggtgcaagccctgcagtccataacatgatgcaattacttatc
aggtcggaaaatgatggtattttgtgtcccattccacagtatcctctatactcagcttca
attgccctccatggtggcttcttggtaccttattatctagatgaagcaagcggttgggga
ttggaaatacctgaactcaagaagcaattggacgctgccaagtctaagggcatcaatgtt
agggctttagttgttataaatcctggcaatccaacggggcaggttctttctgaggaaaat
cagcgccatatagtagatttttgcaagcaagaaggtttggttcttttagctgatgaggta
tatcaagaaaatgtttatgtccctgagaagaaatttcactcattcaagaaggtatctcgg
tccatgggatatggtgagaatgacgtcactttagtatcctttcaatcagtctccaaaggc
taccatggggagtgtgggaaacgaggaggttatatggaggtgactggcttttctgcagaa
gtgagggagcaaatatataaaatggcatctgtcaacctttgctctaatatctctggtcaa
attcttgcaagcttggtcatgagtccacctaaggttggagacgagtcctatgaatcattc
atggctgagaagggaaatattttggcatcgcttgctaggcgtgcaaagacactagaagat
gcattcaacaaactagagggtgtaacatgcaacaaagcagaaggggcaatgtatctgttt
ccccaaattcgtctgtcccaaaaggctatcaaagctgcagaggaggcaaaaactgcacct
gataacttctattgcaagcggttgcttaatgccacaggagtagtagttgttcctggttct
ggttttggacaggttcctggcacatggcatttcagatgcaccattttgccccaagaagaa
aagattccagccattgtctcccgtttgacagagttccatgaaaaattcatggatgagttc
cgtgactaa

DBGET integrated database retrieval system