KEGG   Vibrio anguillarum NB10: VANGNB10_cI0251Help
Entry
VANGNB10_cI0251   CDS       T03657                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00473  D-Alanine metabolism
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VANGNB10_cI0251 (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cI0251 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI0251 (alr)
Enzymes [BR:vau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VANGNB10_cI0251 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Racemase
   VANGNB10_cI0251 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CDQ49169
UniProt: A0A241ND16
LinkDB All DBs
Position
1:298915..300030
Genome map
AA seq 371 aa AA seqDB search
MQALHLTMSNLMSYMKAATACIDLDALKHNLQRVKQQAPNSKIMAVVKANGYGHGLRHVA
KHALGADAFGVARIEEALQLRASGVVKPILLLEGFYSPMDLAVLVTNNIQTVVHCEEQLV
ALEKAQLDVPVNVWLKIDSGMHRLGVRPEQYPDFLERLQACKNVVKPLRYMSHFGCADEL
DKSTTSEQIELFLAMTKGHEGERSLAASAGLLAWKHSQLEWVRPGIIMYGVSPFDDNSAQ
ALGYQPVMTLKSHLIAVRDVKAGESVGYGATWTSLRDTKVGVIAIGYGDGYPRTAPNGTP
VVVNGRKVPIAGRVSMDMLTVDLGPQACDKVGDEVILWGKELPAEEVASHIGTIAYELVT
KLTSRVEMSYQ
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccctgcatttgacgatgagtaatttgatgagctacatgaaagcggcaaccgcc
tgcatcgatctcgatgcgttaaagcacaacctacagcgagtaaaacagcaggcaccaaac
agtaaaattatggcggtggtcaaagcaaatggttatggtcatgggcttcggcatgttgcg
aaacatgcactaggcgcggatgcatttggcgtggcgcgcattgaagaagcgctgcaactg
agagcgagcggtgtggtaaaacctatcttgttgcttgaaggtttttattccccgatggat
cttgctgtattggtgaccaataacattcaaaccgttgttcactgtgaggagcagttagtc
gccttagagaaagctcaattagatgtcccagtcaatgtttggttgaaaatcgatagcgga
atgcatcgtttaggtgtgcgcccagaacaataccccgattttttagaacgtttgcaagcg
tgtaaaaacgtagtgaagccattgcgttatatgagtcattttggttgtgccgatgaactc
gataaatcaaccacttctgagcaaattgagctatttttagcaatgacaaaaggtcatgag
ggtgaaagatctcttgctgcctccgctggtttattagcttggaagcacagccagttagag
tgggttcgcccaggtattattatgtatggcgtttctccttttgatgataactcggcgcaa
gcgctgggctatcaacctgtaatgacattaaaatcacacttgatcgcagtgcgtgatgtt
aaagcgggcgagagtgtcggctacggtgccacttggacaagcttgcgtgacactaaggtt
ggtgttatcgcaattggctatggcgatggttatcctcgcactgcacccaatggaactccg
gttgttgtcaatgggcgtaaagtgccgattgcagggcgagtttcaatggatatgcttacg
gtcgatctcggtccacaagcctgcgataaggtgggcgatgaggttattttatggggaaaa
gagctaccagccgaagaagtggcctctcacatcggcacgatcgcttacgagttagtgacg
aaactcacttctcgtgttgagatgtcgtatcaataa

KEGG   Vibrio anguillarum NB10: VANGNB10_cI1384Help
Entry
VANGNB10_cI1384   CDS       T03657                                 

Gene name
alr2?
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00473  D-Alanine metabolism
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VANGNB10_cI1384 (alr2?)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cI1384 (alr2?)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI1384 (alr2?)
Enzymes [BR:vau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VANGNB10_cI1384 (alr2?)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Racemase
   VANGNB10_cI1384 (alr2?)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Virul_Fac
Motif
Other DBs
NCBI-ProteinID: CDQ50298
UniProt: A0A191W3X9
LinkDB All DBs
Position
1:1644587..1645810
Genome map
AA seq 407 aa AA seqDB search
MNFKASFLTLSIAMALPSFSATSAPLSLNVSEPSIQEIQQSNTWLEIDLGQFKQNIEQFK
SHINSQTKICAVMKADAYGNGIRGLMPTILAQGIPCIAITSNAEARAVRESGFKGQLMRV
RSASIDEIAQSVELDIEELIGSKIQAEQLAQLSQQKGKTIRVHLALNDGGMGRNGIDMST
DAGKQESIAIATQSGIQIVGIMTHFPNYNPDEIRSKLASFNTNSAWLIQQANLKRDELIL
HVANSYTALNVPEAQLDMVRPGGVLYGDLPTNPEYPSIVSFKTRIASLHHLPKGSTVGYD
STYRVTKESVLANLPVGYSDGYPRKMGNRGDVLINGQRAKVVGVTSMNTTLVDVTDVKGV
LPNQEVTLFGAQKQGRITVSELEENAELIFPELYTIWGTANPRFYIH
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaaagcctcttttcttacactgtcaattgccatggctttaccctctttttca
gcgacttctgcacctttaagccttaacgtcagtgagccttctatacaagaaattcagcaa
tccaatacttggcttgagatcgatcttggccaattcaaacaaaatattgagcagtttaag
agccacatcaacagccaaactaaaatttgcgccgtgatgaaggctgatgcttacggcaac
ggtattcgcggtttaatgccaactattctcgcgcaagggatcccttgtatcgcaattacc
agtaatgcagaggctagagccgtacgtgagagcgggtttaaaggccagttgatgcgtgtt
cgctctgcgagcattgatgaaatcgcacaaagtgtcgagttagatatcgaagagctaatc
ggtagtaaaatacaagctgagcaactcgctcagctaagccagcaaaaaggtaaaacgata
agagtacatttggcattaaatgatggcggtatgggacgcaatggtatcgatatgtcaacc
gatgcaggaaaacaagaatcgattgcgattgctactcaaagtggcatacaaattgttggg
ataatgactcatttccccaattacaatccagacgaaatccgcagcaagttggccagtttt
aataccaattcagcttggttgattcagcaagcaaacctaaaacgcgatgagctgattttg
catgttgccaactcctacactgctctcaatgtaccagaagcacaacttgatatggtacgt
cctggcggcgtcctatatggcgacttaccaactaacccggaatatccgtcaatcgtctca
ttcaaaacacgtattgcgtcattgcatcatcttcctaaaggaagcactgttggctatgac
agtacataccgcgtaaccaaagagagtgttttggcaaatctgcctgttggctattcagat
ggttacccaagaaaaatgggcaatcgcggtgacgtattgattaacggtcaacgagcaaag
gtggttggagtaacttcaatgaacaccacattggttgacgtaaccgatgtgaaaggcgtc
cttcctaatcaggaagtcaccttgtttggcgcgcaaaagcaaggccgaatcactgtcagt
gagctggaagaaaatgcagagctcatattccctgaactgtatacgatttggggaacggca
aaccctcgtttctacatccactaa

DBGET integrated database retrieval system