KEGG   Vibrio anguillarum NB10: VANGNB10_cI1050cHelp
Entry
VANGNB10_cI1050c  CDS       T03657                                 

Definition
(GenBank) pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00250  Alanine, aspartate and glutamate metabolism
vau00410  beta-Alanine metabolism
vau00430  Taurine and hypotaurine metabolism
vau00650  Butanoate metabolism
vau01100  Metabolic pathways
vau01110  Biosynthesis of secondary metabolites
vau01120  Microbial metabolism in diverse environments
vau02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vau00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VANGNB10_cI1050c
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VANGNB10_cI1050c
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VANGNB10_cI1050c
   00430 Taurine and hypotaurine metabolism
    VANGNB10_cI1050c
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    VANGNB10_cI1050c
Enzymes [BR:vau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VANGNB10_cI1050c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: CDQ49964
UniProt: A0A1Y0NU84
LinkDB All DBs
Position
1:complement(1244131..1245774)
Genome map
AA seq 547 aa AA seqDB search
MVSEQKTANVSFESLLRIFTVPEGPDSTLTKIDQELSRNLNLFLREHIVAEEKPLKEIEK
DFSNPQIPESPEFVSEHTQHLLDNLVAHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYQKNDAFYSQWMHSANHSLGAFCSGGTIANITA
LWVARNNALKADGDFQGVEKEGLFKAMRHYGYHGLAILVSDRGHYSLKKAADVLGIGQEG
LVCVKTDHNNRLCPQDLKAKMAHLKSQKIKSFAVVGVAGTTETGNIDPLRDIANICQQEG
CHFHVDAAWGGATLMSNNHRHLLNGIELADSVTIDAHKQLYIPMGAGMVLFKKPDAMHSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYASMHIISRPGYELLIDQSLAKARYFADL
IKEQDDFELISEPELCLLTYRYIPAFVRQALQQALPNQKAELNELLNEITQFVQKKQRET
GRSFVSRTRLNPERWDKLDTIVFRVVLANPLTTHAILHSILDEQRHIATLAPNLMAKIEL
LAQRIIS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggtatcagaacaaaaaactgcaaatgtgagtttcgagagcttgttacggatcttcact
gtgcccgaaggccccgactcaacactgacaaaaatagaccaagagctatcgcgcaatttg
aacctcttcttgcgtgaacatattgtcgctgaagaaaaaccactcaaagagatcgaaaaa
gatttctctaatccgcaaattccagagtcaccggagttcgtttcagaacatactcagcat
ttgttggataatttagtcgctcattcagtgcatacctcggctcctagctttattggtcat
atgacatctgcactgccatatttcttgatgccgttatcaaagatcatgattgcgctgaat
caaaacttagtcaaaattgaaacgtcaaaagcgtttacaccgctagaacggcaggttttg
ggtatgttgcatcgtttgatctatcaaaaaaacgacgctttttacagccaatggatgcat
agcgctaatcattcgctcggtgcattttgctctggcggaacaattgccaatatcacggca
ttgtgggtggctcgtaataatgctttgaaagccgatggtgatttccaaggcgtcgaaaaa
gaggggctgtttaaagccatgcgtcattatggttaccacgggttagccattttagtgtct
gatcgtggccattactctttaaagaaagccgctgacgtattgggtatcggccaagaaggc
ttggtttgtgtaaaaaccgaccacaacaaccgcttatgcccacaagatttgaaagccaaa
atggcacacctaaaaagccagaaaattaaatcttttgcggttgttggcgtcgccggaacg
acagaaacgggcaacattgatcccttaagagatatcgccaatatttgccagcaagaaggt
tgtcattttcacgtagacgccgcttggggcggtgcaacattaatgtcgaataatcaccga
cacttactcaatggtattgagttggctgactccgtcacgattgatgcacataaacagctc
tacatccctatgggtgcaggcatggtactattcaaaaagcctgatgctatgcattcaatt
gagcaccatgcgcagtatattttgcggaaaggttcaaaagatctaggcagccatacgtta
gaaggttctcgttcaggtatggccatgttggtgtacgctagcatgcacattattagtcgc
cctggctacgaattattgattgaccaaagcctagctaaagctcgctatttcgccgatcta
attaaagaacaagacgattttgaactgatttctgaacccgaactgtgtcttttaacctat
cgttatattcctgcttttgttcgccaagcactgcaacaagccttgcctaatcaaaaagca
gaactgaacgagttgctaaatgaaatcacccagtttgtgcagaaaaaacaaagggaaacg
gggcgttcatttgtctctcgaactcgtttaaacccagaacgctgggacaagcttgatacc
attgtatttcgcgtggtactagccaacccgctaacaacacatgctatcttgcactcgatc
ttagatgagcagcgacatattgccacgctagcccctaatttgatggccaaaattgagcta
cttgctcaaagaatcatcagctag

DBGET integrated database retrieval system