KEGG   Vibrio anguillarum NB10: VANGNB10_cI1263
Entry
VANGNB10_cI1263   CDS       T03657                                 

Gene name
rlmL
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase L
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vau03009]
    VANGNB10_cI1263 (rlmL)
Enzymes [BR:vau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     VANGNB10_cI1263 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     VANGNB10_cI1263 (rlmL)
Ribosome biogenesis [BR:vau03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VANGNB10_cI1263 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 THUMP Methyltransf_25 Methyltransf_11 Methyltransf_15 Methyltransf_24 TRM Methyltransf_23
Other DBs
NCBI-ProteinID: CDQ50177
LinkDB
Position
1:1493919..1496048
AA seq 709 aa
MNQYLAVTSNGLENLLVEELTKLGITDAKPVQAGVKFKASKEQIYRCCLWSRLASRFVRV
LSEFTCQNDMDLYLSASSVNWVNHFHSSKKFVVDFNGTNNEIRNSQYGAMKVKDAVVDCF
TKKNLPRPSIDKDHADLRVHVRLHKDKAILGIDMVGGGLHQRGYRTEAGRAPLRETLAAA
IILRSGWSEAKPLLDPMCGSGTLLIEAAMIAAGMAPSLKRPKWSFEALEDFDAELWAQIK
SEANVQARRGVKKVDCKFFGFDNDARVLQTAKDNARRAGVEELITFQLGDAALIKRPEEF
EDGVVICNPPYGERLGTHPGLIALYTAFGGQLKAEFGGCQASIFSSSDELLSCLRMRAEK
QFKLNNGALPCHQKNYSISLRTVEPGASISQESVIAPDFSNRLKKNIAKIGKWAKRESLD
CYRIYDADLPEYNVAIDVYLDHLVIQEYAAPKDIPEEKAKRRLTDIIRAAIQVTGTEANK
VVLKVREKQKGRSQYQKLGQISETMEVNEYGVKLIVNLHDYLDTGLFLDHKLTRRRLGQM
AKGKDFLNLFAYTGSATVHAACGGAKSTMTVDMSKTYLEWAKDNLKLNGQVGHQHRFEQA
DCVQWLETAKEQFDLIFIDPPTFSNSKRMEHTFDVQRDHIKLMENLKRILRPEGTIVFSN
NKRHFKMDLEALAELGLVAQNISAQTLPLDFERNKQIHNCWTISHACSE
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgaatcaatatctagcggttacctcaaacggtcttgagaacctattagttgaagaacta
accaaattagggattacggacgcaaaacccgtgcaggccggggtaaaatttaaagcgtcg
aaagagcagatttatcgctgttgtttgtggagccgtctagcatcaagatttgttcgcgtc
ctctctgaatttacctgccaaaatgatatggatctttacttgtcagcaagttcagtgaac
tgggttaatcattttcatagttcgaaaaagtttgttgtcgacttcaacggcacaaataac
gaaattcgcaacagtcagtatggcgcgatgaaagtaaaggatgcggttgtcgactgtttt
accaaaaagaacttaccgcgcccttcgatcgataaagatcatgcagatcttcgtgtccat
gtacgcttgcataaagataaagccattttagggattgatatggtgggcggtggtttacat
cagcgcggttaccgtaccgaagcggggcgagcaccacttcgtgaaacattagcagcggct
attattttgcgtagtggatggagtgaagcgaagccactgctcgacccaatgtgtggttct
ggtactttgctcattgaggcggccatgatagctgctggtatggcccctagtctcaagcgt
ccaaagtggagtttcgaagctttagaggattttgatgcagagctgtgggcgcaaataaaa
tcagaggctaatgttcaagcaagacgtggtgtcaagaaagttgactgtaagttctttggt
tttgataacgatgcacgagtgctgcagaccgcgaaagataacgctcgccgcgcaggggtt
gaagaactgattaccttccagctaggtgatgcggcactgatcaaacgtcctgaagagttt
gaggatggtgtggttatctgtaacccaccctatggtgaacgtttaggtacacatcctggt
ttgattgctttatacacggcatttggtggtcaattaaaggctgaatttggcggttgccaa
gcgtcgattttctcaagctctgacgaattactcagttgtttgcgtatgcgcgctgaaaag
cagtttaagttaaataacggtgcgttaccttgtcaccaaaagaactactcaatttcattg
cgcacggtagaaccgggagcgtctatttctcaagaatcggtgatcgctcctgatttttcg
aatcgtttaaagaaaaatattgcgaaaattggtaagtgggcgaaacgtgaatcactagat
tgctatcgtatttatgatgctgatttgcctgaatacaatgttgcgatcgatgtttatctc
gaccacctagtgatccaagaatacgccgcacctaaagatattccagaagaaaaggcgaaa
cgccgtttaacagatatcattcgtgccgcgattcaagtcaccggaacagaagcaaataaa
gtggtactcaaagttcgtgaaaaacagaaaggacgctctcaatatcaaaaattagggcaa
atttctgagacaatggaagtgaacgagtatggcgttaaactgattgtcaatttacatgat
tatctcgatacgggtttattccttgatcataaattgacgcgtcgtcgcttagggcaaatg
gcaaagggtaaagacttcctcaatctatttgcttacaccggctctgcaaccgttcatgcc
gcttgcggtggagcaaaatcaactatgacggttgatatgtctaaaacctatttagaatgg
gctaaagacaacttaaagctcaacggtcaagttggacaccagcatcgctttgaacaagcc
gactgtgtgcaatggctagagactgcaaaagaacaatttgatttgatatttatcgatccg
ccgacattctcaaattccaaacgtatggaacacacatttgatgtgcaacgcgatcatatt
aagttgatggaaaatttaaaacgtatcctacgtccagaaggtacgattgtgttttcaaac
aataaacgacattttaaaatggatttagaagcgctagctgagcttggtttagttgctcaa
aacatttcagcacaaacattaccactggattttgaacgcaataagcagatccacaactgc
tggacgatttcccatgcatgcagtgaatag

DBGET integrated database retrieval system