KEGG   Vibrio anguillarum NB10: VANGNB10_cI1857Help
Entry
VANGNB10_cI1857   CDS       T03657                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vau  Vibrio anguillarum NB10
Brite
Enzymes [BR:vau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VANGNB10_cI1857 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDQ50769
UniProt: A0A191W555
LinkDB All DBs
Position
1:2174299..2174883
Genome map
AA seq 194 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLDFHHGKHHNTYVVKLNGLIPGTEFEGKSLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEAFKAKFTDSAINNFG
SSWTWLVKNADGSLEIINTSNAATPLTHEGVTPLLTVDLWEHAYYIDYRNLRPDYMNGFW
ALVNWAFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattaccagctttgccttacgctaaagacgctctagaaccacacatttca
gccgaaacactagatttccaccacggtaagcaccacaacacttacgttgtgaagcttaac
ggccttatccctggcactgaatttgaaggtaaatctctcgaagagatcatcaaaacttca
actggtggcgtgtttaataacgccgctcaaatttggaaccacaccttctattggcactgc
cttgcaccaaatgcaggtggcgaaccaacaggtgccgttgcagacgcaatcaacgccgca
tttggttcttttgaagcttttaaagcaaaattcactgactcagcgatcaataactttggt
tcatcttggacttggttggtgaaaaatgcggatggttctttagagatcatcaacacttca
aatgcagccacaccactgactcacgaaggtgtaactccgctactgacggttgatctgtgg
gaacacgcttactacatcgattaccgtaacctacgccctgactacatgaatggtttctgg
gcactggttaactgggcattcgttgcagaaaacctagcaaaataa

DBGET integrated database retrieval system