KEGG   Vibrio anguillarum NB10: VANGNB10_cI2169cHelp
Entry
VANGNB10_cI2169c  CDS       T03657                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(penta peptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cI2169c (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cI2169c (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI2169c (murG)
Enzymes [BR:vau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     VANGNB10_cI2169c (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Glycosyltransferase
   VANGNB10_cI2169c (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: CDQ51081
UniProt: A0A1Y0NXT7
LinkDB All DBs
Position
1:complement(2520440..2521501)
Genome map
AA seq 353 aa AA seqDB search
MINNKRLMVMAGGTGGHVFPGLAVAKQLQQQGWQIRWLGTADRMEAELVPKHGIEIDFIQ
VKGLRGQGIGRLLKAPFQIVNAIFQARRYLKQWQPDAVLGMGGYVSGPGGVAAWSMGIPV
VLHEQNAVAGLTNRWLSKIAKRVFQAFPGAFTEAQVVGNPVRQDVATLPEPQVRFAERNE
PIRILVMGGSQGAQILNRTLPDVLAMLGDNYQVCHQAGKNNQQSVEQAYRALQIKNAHVT
EFIEDVAGAYAWADLLVCRSGALTVSEVAAAGVGAIFIPFMHKDRQQALNADHLVACGAA
KMIEQPQLTVEKLAQEIASLERHDLLLMAQQARAAAQLDADKVVANAIIALTQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgataaacaataaacgtttaatggttatggctggtggcacggggggacatgtttttccc
ggtctcgctgtggctaaacagctccaacaacaaggttggcagatccgctggctagggact
gctgatcggatggaagcagaattagtgcctaaacatggtattgagatcgactttattcag
gtcaaaggtttacgtggccaaggcatagggcgtttgctgaaagcgccttttcaaattgtg
aacgcgatttttcaagcgcgtcgttatttgaagcagtggcaacctgatgcggtgctcggc
atgggcggatacgtcagtggccccggtggcgtggcagcgtggtctatgggaattcccgtt
gtgcttcacgagcaaaatgccgtagcagggttaaccaaccgttggctttcgaaaattgcc
aaacgcgtatttcaagccttccccggagcctttactgaggcgcaagtcgtaggtaaccct
gtacgtcaagatgtcgctacattacccgagccgcaagtacgctttgctgagcgaaatgaa
ccgatccgcattctcgtgatgggcggcagccaaggtgcgcagattctcaaccgaactttg
cctgatgtgctagctatgcttggcgataattaccaagtttgccatcaagcaggcaagaat
aatcaacagtcggttgagcaagcttatcgcgcgcttcagatcaaaaatgcacacgttact
gagttcattgaggatgtggctggcgcttatgcgtgggctgatttactggtgtgccgctcg
ggagcattaacggtttctgaagtggcagcggccggtgttggcgctatatttatccctttt
atgcataaagaccgacagcaagcgcttaacgcggatcacttagtcgcttgtggtgcggcc
aaaatgattgaacagccgcagctcacagtagaaaaactagcgcaagagattgcttctctt
gagcgtcatgatctgctgttgatggcgcaacaagcgcgtgcagccgcacaactggatgct
gataaagtcgttgccaacgctatcatcgcacttacccaataa

DBGET integrated database retrieval system