KEGG   Vibrio anguillarum NB10: VANGNB10_cI2171cHelp
Entry
VANGNB10_cI2171c  CDS       T03657                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00471  D-Glutamine and D-glutamate metabolism
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    VANGNB10_cI2171c (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cI2171c (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI2171c (murD)
Enzymes [BR:vau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     VANGNB10_cI2171c (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Amino acid ligase
   VANGNB10_cI2171c (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_9 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: CDQ51083
UniProt: A0A1Y0NV95
LinkDB All DBs
Position
1:complement(2522706..2524025)
Genome map
AA seq 439 aa AA seqDB search
MDRWQTVNNVVVVGLGMTGLSVVNYLLSLDRSLTIKVIDTRENPPGREHLSSQVELHCGG
WNQAWLFDADLIVTNPGIALATPEIQQALARHIPVVGDIELFAWQVDKPVIAITGANGKS
TVTDLTGVLAKAAGVKVAVGGNIGVPALDLLQQEADLYVLELSSFQLETTSSLKLVSAAF
LNLTEDHMDRYDGMESYRQAKLRIFKYAQAAVVNADDSQTEPPSFSGHIARFSVEHDADY
CTQMIDGKSFLVAKGTPLLASEELSLVGRHNSANVLTVLALLDLAGVDYSSALDALKSYR
GLTHRCQVVADNHGVKWVNDSKATNVASTQAALSGLNCQGTLYLLVGGVGKGADFSPLAP
ILKTLNVKLCCFGVDGGQFMPLHPSAQFYSSMEEIIVSIKPQLRRGDMVMLSPVCASFDQ
FKNFMARGDAFAELAQRYA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttggcaaactgttaataatgtggtggtcgtggggctgggtatgacgggcctc
tcggtggttaactaccttttgagcttagatcgctcgctcacgattaaggtgatcgacacg
cgggaaaacccgccaggtcgagagcatttaagctcgcaagttgagctacattgtggtggc
tggaaccaagcttggttatttgacgcagacctgattgtgactaatccaggcattgcttta
gctacgccagagattcaacaggcgttagcacgacatattcccgtggtgggcgatattgag
ctctttgcttggcaggtggataagcctgttatcgctatcacaggagccaacggtaagagc
acagtgacggatttaaccggagtacttgctaaagctgctggggttaaggttgccgttggc
ggcaatattggtgtgcctgctttagatctacttcagcaagaggccgatctttatgtgctg
gagctctcaagcttccagctagaaacgacctcaagtttaaaactcgtctctgctgccttt
ctcaatctgactgaagatcatatggatcgctacgatggtatggaatcgtatcgccaagct
aaattgcgcatttttaagtatgcgcaagcggcggtcgtgaacgccgatgatagccagacg
gaacctccctcattttcaggtcacatcgcacgtttttccgttgaacatgacgcggactat
tgcacgcaaatgattgatggcaaatcgttcttagtggcgaaaggcacgccattgttggca
agcgaggaactcagcttagtgggacgacacaatagtgctaacgtgctcactgtgctcgca
ctgctcgatttggcgggtgttgattactcatctgcgcttgatgcattgaaatcttaccgc
gggctgacacatcgttgtcaggttgttgctgataatcacggcgtaaaatgggtcaatgac
tcgaaagcgaccaatgtcgcaagcactcaagcggcgttgtcggggttaaattgccaaggg
actttgtatctgcttgtggggggcgttggcaagggcgctgatttctcgccattagcaccg
atactaaaaacattgaacgtaaaactgtgctgttttggcgttgacggtgggcaattcatg
ccactgcatccatcggctcagttctattcatcgatggaagagattatcgtatcgatcaaa
ccgcagctgcgtcgtggtgatatggtgatgctttcgcctgtttgtgccagttttgatcag
tttaaaaactttatggccagaggtgacgcctttgccgagcttgcgcagcgttacgcttaa

DBGET integrated database retrieval system