KEGG   Vibrio anguillarum NB10: VANGNB10_cI2172cHelp
Entry
VANGNB10_cI2172c  CDS       T03657                                 

Gene name
mraY
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transfera se
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cI2172c (mraY)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cI2172c (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI2172c (mraY)
Enzymes [BR:vau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     VANGNB10_cI2172c (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Glycosyltransferase
   VANGNB10_cI2172c (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1 Ndc1_Nup
Motif
Other DBs
NCBI-ProteinID: CDQ51084
UniProt: A0A1Y0NZI1
LinkDB All DBs
Position
1:complement(2524059..2525141)
Genome map
AA seq 360 aa AA seqDB search
MIIWLADLLQPYFSFFRLFEYLSFRAIVSILTALALSLWMGPRLIKRLQLLQIGQVVRND
GPESHFSKRGTPTMGGVMILASIITTVLLWTDLSNPYVWAVLAVLLGYGVVGFVDDYRKV
VRKNSDGLIARWKYFWQSAIALIVAFALYAHGNDTAATQLVVPFFKDVMPQLGLLYIVLT
YFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFASYLHIPYVPYASELV
VVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIMGGVFVME
TLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVGLATLKVR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattatttggctcgcggatctactccagccatacttctctttttttcgtctgttcgaa
tatctctcatttcgggccatcgtcagtattttaaccgcacttgctctgtcgttatggatg
gggccgcgtttgattaaacgtttgcaactactgcaaattggtcaagtggtgcgtaacgat
ggtccagaatcacattttagtaagcgcggtacgccaaccatgggcggtgttatgatcctc
gcctctatcattactaccgtactgctgtggacagatctctcaaacccttacgtgtgggct
gtactcgcggtgctgcttggttatggcgtcgtcggttttgtggatgattatcgcaaagtg
gtgcgtaaaaacagtgatggattgatcgcgcgctggaaatacttttggcagtcggccatt
gcgttgatagtggcgtttgctctctatgcacatggcaacgataccgcagctactcagctt
gtggtgcctttctttaaagatgtgatgccgcaactgggcttgctctacattgtgctgacc
tattttgtcatcgtcggaaccagtaacgcggtgaacttaaccgatggtctggacggttta
gccatcatgccgactgttttggttgctgccggttttgctgtgattgcatgggcaactggg
aacgtcaatttcgccagttatctgcatattccttatgttccttatgcctcagagttggtg
gtggtgtgtactgcaattgtgggggccggtttaggttttctgtggttcaacacttatcct
gcgcaagtctttatgggcgatgtgggttcactcgctctaggcggtgcactcggtacaatt
gcggtgttggttcgtcaagagtttgtgttagtgatcatgggcggcgtgtttgtgatggaa
accttgtcggtgattttacaagtcggttcctacaaattgcgtggtcaacgtattttcagg
atggcccctatccatcaccactatgaattgaaaggttggccagaaccacgcgtgatcgtc
cgtttttggattatctcaattgtgttggtgttagtgggtttggctacactaaaagtgcgc
tag

DBGET integrated database retrieval system