KEGG   Vibrio anguillarum NB10: VANGNB10_cI2174cHelp
Entry
VANGNB10_cI2174c  CDS       T03657                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00300  Lysine biosynthesis
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    VANGNB10_cI2174c (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cI2174c (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cI2174c (murE)
Enzymes [BR:vau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     VANGNB10_cI2174c (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Amino acid ligase
   VANGNB10_cI2174c (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: CDQ51086
UniProt: A0A1Y0NVT2
LinkDB All DBs
Position
1:complement(2526493..2527980)
Genome map
AA seq 495 aa AA seqDB search
MTPSMCLQDLIAPWLDLDGHSISTLSVTRLVLDSRKISPNDTFIAVVGHAIDGRQFIDSA
TQAGANLVLAQACGQHPHGSMTTVNGVLVIYLADLNQHLSQLASRLYRLKTSTLIGVTGT
NGKTTITQLIAQWIDLLGEKAAVLGTTGNGFLNHLQPAANTTGNAIEVQETLYQLAQQGA
RYTALEVSSHGLVQGRVQALKFAVGVFSNLSRDHLDYHGTMEEYAKAKLSLFTAHHCQHA
VINADDAVGASWLAQLKAPIAVSLKQQPQCAKALWASLVSYSDNGISLTFDGYYGQGELS
VPLIGEFNASNLLLAFATMLTLGFDKQALMTTASQLQPVLGRMELFQAPNRAKIVVDYAH
TPDALEKALLALRVHCQGQLWAIFGCGGDRDKGKRPMMAEIAERCADKVILTDDNPRSEK
PADIVQDMVAGLEFASRAHVEHNRYAAVQYALQHADQQDIILLAGKGHEDYQVMAHQTIH
YSDRETAQTLLEISA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgagtatgtgtttacaagatctcatcgccccttggcttgacctcgatggccat
tctatttcaacgttgtcggtgactcgtttagtgctcgatagccgtaaaatatcacccaat
gatacctttattgcagtggtcggccatgccatcgacggaaggcagtttattgatagtgcc
actcaagctggggcgaatctggtattggctcaagcgtgtgggcagcatccgcatggcagt
atgactacggtcaatggcgtgttagtgatttaccttgctgatctaaaccaacatctatct
caactggcatcgcggctttaccgcttgaagaccagtacgttgattggggttacgggaacc
aacggtaaaaccaccattactcaattaatcgcgcagtggattgacttgttgggcgagaaa
gcggcggtgctgggtacgacggggaatggttttctcaaccatttacagcctgccgccaat
accacaggtaatgccattgaggtccaagaaacactctatcaattagcgcagcagggcgct
cgctataccgctctggaagtctcttcgcacggattagttcaagggcgagttcaagcattg
aagtttgctgtgggcgtgttttctaacttaagtcgcgatcatctcgattatcatggcacc
atggaagagtacgccaaagcaaagctctccttatttaccgctcatcactgccaacacgct
gtcattaatgccgacgatgcggtgggtgcgagttggttagcacagctgaaagcaccgatt
gccgtctctttaaagcagcaaccgcaatgcgctaaagcgctgtgggctagcttggtctct
tacagtgataatggtatttcattaaccttcgacggctactatggtcaaggtgaattgagc
gtgccgttgattggcgaatttaacgccagcaatcttctactcgcttttgccactatgctg
actttaggttttgataaacaagccttgatgacaacggcttctcaactgcagccagtctta
gggcgaatggagctctttcaagcgccaaatcgtgcgaagatcgtcgttgattatgcacac
acgcctgatgctttggaaaaagcattattagcacttcgcgttcattgccaaggtcagcta
tgggcgatttttggttgtggtggcgaccgtgataaaggcaaacgcccgatgatggccgaa
attgcagagcgctgcgccgataaggtcattttgaccgacgataaccctcgtagcgaaaaa
ccggcagacattgtgcaagatatggtggcagggcttgagtttgcaagtcgcgcacacgtt
gaacacaatcgttacgctgccgtgcaatacgccctgcaacatgctgatcagcaagacatc
attttattggcaggcaaagggcatgaagattatcaagtgatggcccatcaaactattcac
tattcggatcgcgaaacggcgcaaaccttactggagataagtgcatga

DBGET integrated database retrieval system