KEGG   Vibrio anguillarum NB10: VANGNB10_cII0448cHelp
Entry
VANGNB10_cII0448c CDS       T03657                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase-like protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00473  D-Alanine metabolism
vau00550  Peptidoglycan biosynthesis
vau01100  Metabolic pathways
vau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VANGNB10_cII0448c (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VANGNB10_cII0448c (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VANGNB10_cII0448c (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
    VANGNB10_cII0448c (ddl)
Enzymes [BR:vau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VANGNB10_cII0448c (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:vau01011]
 Precursor biosynthesis
  Amino acid ligase
   VANGNB10_cII0448c (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CDQ48345
UniProt: A0A241NLB8
LinkDB All DBs
Position
2:complement(502704..503708)
Genome map
AA seq 334 aa AA seqDB search
MTQTTILLLCGGGSSEHEVSLVSANYLQAQLEKTEGFQVIRVEMRPDGWYSEKGDLSFLD
TNAATLNTNGVAVNIDFVVPCIHGYPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALGIPNTPYLFLSENNAQAHQQCKQALEKWGSVFIKAARQGSSVGCYKVTEVSQL
NSAIDAAFSYSEQVLVEKAVKPRELEVAAYQLDGVLYLSKPGEIIAPEDAFYTYEEKYSA
ASHSMTEVQAQNLTREQLEMISDCAARVFTHMKLRHLARIDFFLTPEGNIYLNEVNTFPG
MTPISMFPKMLEHNGHRFHEFLANCVTTSLNQKV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacaacaatcctattattatgtggtggcggttcgtcagaacatgaagtttca
cttgtgtcagccaactatttacaagcacaacttgaaaaaacagaaggttttcaagttatt
cgcgtcgaaatgcgacccgatggttggtacagtgaaaagggcgacctgagtttcttagac
acgaatgctgcaacgttgaataccaatggtgttgccgtcaatatcgattttgtggttcct
tgcattcatggttatccaggggaaacgggcgacattcaatcgatgctcgagctggctggc
atcccatatttaggttgtggtccagaagccagtgctaacagctttaataaaattacatct
aagctttggtacgatgcgctgggtattcctaatacaccttatctttttctttcagaaaat
aatgcacaagcgcatcagcagtgtaagcaggctctggaaaaatggggaagtgtgtttatt
aaagcggcgagacaaggctcatctgttggttgttacaaagtcaccgaggtttcacagctc
aacagcgcaatcgatgcggcttttagctactcggaacaagttctggttgaaaaagcagtg
aaacctagggaattagaagttgccgcttatcagcttgatggtgttttatatctttctaag
ccgggtgagatcatcgcaccagaagacgcattttatacttatgaagaaaaatacagtgcg
gctagccattcgatgactgaagtacaagctcagaatttaaccagagaacaattagaaatg
ataagtgattgtgctgctagggtttttacccacatgaagcttaggcaccttgcacgtatt
gatttctttttaaccccagagggaaacatttatcttaatgaagttaacaccttccctggc
atgactcccatttcaatgtttcctaaaatgttagagcataatgggcataggtttcatgaa
tttctagccaattgcgtgacaacgtcactcaatcaaaaggtttaa

DBGET integrated database retrieval system