KEGG   Vibrio anguillarum NB10: VANGNB10_cII0469cHelp
Entry
VANGNB10_cII0469c CDS       T03657                                 

Definition
(GenBank) Putative glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VANGNB10_cII0469c
Enzymes [BR:vau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     VANGNB10_cII0469c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C GST_N_3 GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CDQ48366
UniProt: A0A191W7U7
LinkDB All DBs
Position
2:complement(529010..529678)
Genome map
AA seq 222 aa AA seqDB search
MIELYTAATPNGQKISIALEEMGLPYKVNAFDLSTNQQKEPEFTAINPNGRIPAIVDKDN
DDFPVFESGAILLYLAEKTGKFLPVDPKARSQVIQWLMFQMGGVGPMMGQANVFFRYFPE
KIQPAIDRYQKEGRRLFEVMDSQLEHHRYLAGDEYTIADIATWPWVRIYEWSGINIDGLE
HLQRWLAEIAQRPAVIKGLTVPPPSQESDEQRAERIQKMVTR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactgtataccgccgcaacgccgaatggtcagaaaatctccattgcattagaa
gaaatggggttgccatacaaggtcaacgcttttgatctttcaaccaatcagcaaaaagag
cctgagtttacggccatcaatccgaatggacgcattcccgcaattgtagataaagataac
gatgattttccagtatttgaatctggggcaattttgctttacttagcagaaaaaacggga
aaatttttgcccgtagatccgaaagcccgctctcaagtgatccaatggttaatgtttcaa
atgggaggcgtagggccgatgatggggcaagctaatgtcttctttcgttactttccagaa
aaaatacaacctgccattgatcgttaccaaaaagaagggcgacgtctatttgaagtcatg
gatagccaattagagcatcaccgttatcttgcgggtgatgaatacaccatcgccgatatc
gcaacatggccatgggtgagaatttacgaatggagtggcattaatattgacgggcttgag
cacctacaacgttggttggcggaaatcgcgcaacgccctgcagtgattaaggggcttacc
gtgccaccaccaagtcaagaaagcgatgaacagcgagcggaacgcattcagaaaatggtg
acaaggtaa

DBGET integrated database retrieval system