KEGG   Vibrio anguillarum NB10: VANGNB10_cII0471Help
Entry
VANGNB10_cII0471  CDS       T03657                                 

Definition
(GenBank) putative uncharacterized protein
  KO
K16137  TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon
Organism
vau  Vibrio anguillarum NB10
Brite
KEGG Orthology (KO) [BR:vau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vau03000]
    VANGNB10_cII0471
Transcription factors [BR:vau03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    VANGNB10_cII0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_13 TetR_C_11
Motif
Other DBs
NCBI-ProteinID: CDQ48368
UniProt: A0A1Q1MGP9
LinkDB All DBs
Position
2:530401..530985
Genome map
AA seq 194 aa AA seqDB search
MARKSNFDREEKLIVAMDLFWKKGYSNTAISDLIDTLKINRFSLYNAYGDKKTLYYEALD
KYLVSVPLPRLAELNQTNSAFEELTAFLKEFAKLQKTSSSGCFMQNALIEHAGQDEYVLA
KGQQLFDQLLAVISHALRNAQEQKQIGTLLDANQLAKLVLVQMQGIRVMGKAKRYDDINA
ALESLLILLKGNAP
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaaaagtaatttcgatagagaggaaaaactgattgtggcaatggatctgttt
tggaaaaaagggtactccaataccgccatttccgatctaattgatacgctgaaaattaac
cgttttagcctttataatgcgtatggtgataaaaaaacgctctattacgaagcattggat
aaatatctggtatcagtgccactccctcgccttgctgaacttaaccaaacgaactcagcg
tttgaagaattgactgcttttcttaaagaatttgcaaaattgcaaaagacaagttcatcg
ggatgcttcatgcaaaacgccctgattgaacacgcagggcaagatgagtatgtgttagca
aaaggccaacaactttttgaccagttactagccgttattagtcacgcactacgaaacgcc
caggagcaaaaacaaattggtacattgctggatgcaaatcaattagcaaaactggtactg
gtccagatgcaaggaattcgtgtaatgggaaaagctaagcgttatgacgacattaatgct
gccttagaatcgttattgatattgcttaagggaaatgctccatga

DBGET integrated database retrieval system