KEGG   Vibrio anguillarum NB10: VANGNB10_cII0498Help
Entry
VANGNB10_cII0498  CDS       T03657                                 

Definition
(GenBank) transposase, ISVa6 (IS30 family)
Organism
vau  Vibrio anguillarum NB10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_38 rve HTH_23 HTH_11 HTH_32 HTH_29 HTH_7 rve_3 HTH_35 HTH_36 Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: CDQ48395
LinkDB All DBs
Position
2:551970..552938
Genome map
AA seq 322 aa AA seqDB search
MRYTHLTENERYMISALRKQGISTAKIAKQLGRHKATIYREIERNSRYNRHFKRYSYQAW
RAQQMARNRLSRSRRNKRYSEIDFRLPEALLRLDWSPDQIVGYLRVRGYPTMSHELIYQH
IWNDKSLGGTLWKHLRQSTKKRRKRYNSKDSRGRLAAKRHITERPAKAEHRKEPGHWEID
TVVGRGTKHCIVTLVDRMTGYTFIGQMDDRTSESLNVRMSKIMTRSDLPFKTITADNGTE
FHGYAQLEKHHNCLFYFANPYHSWERGTNENTNGLIRQYLPKRTSMSHVTQKLCNEIAHK
LNTRPRKRLGYRTPTEYIHAHL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagatacacgcacctcactgagaacgaaaggtatatgatttctgcgctcagaaagcaa
ggaattagtaccgctaaaatagctaaacaactgggtcgtcacaaagcgactatctatcga
gaaattgaacgcaattcccgatacaacagacactttaaaaggtactcctatcaggcgtgg
agagcccaacaaatggctcgcaacaggctgagccgctcgcgcagaaataagcgttacagc
gaaatcgacttcaggttacctgaagccttgctgcgactggattggagccctgaccaaatc
gttggatacctaagggtaagaggctatccaacaatgagccacgagctcatttatcagcat
atttggaacgacaaaagtctcggtggaacactatggaaacacctacgccaatccaccaag
aaaaggcgtaaaaggtataactcaaaagacagccgaggtcggctggcagcaaagcgtcat
attaccgaaagaccagcaaaagctgagcatcgaaaagagcctggtcactgggagattgat
accgtcgtgggccgcggaactaagcactgcatcgtgactttagtcgacagaatgactggc
tacacttttattgggcaaatggacgatagaacaagcgagtcgctcaacgtaagaatgagc
aaaatcatgacccgctctgacttaccttttaagacgataactgcggataacggcactgag
ttccatggttatgcacaactagagaaacatcataactgtctgttttactttgcaaatcca
taccactcatgggagcgaggcactaatgaaaacaccaatggtttgatacgacaatactta
ccaaaacgaacttctatgtcacacgtgacacagaagctctgcaatgaaattgcacacaaa
ttaaatacgcgcccacgcaaaagacttgggtataggacaccaacggagtatattcatgcg
catctgtag

DBGET integrated database retrieval system